CAZyme Information: CPC735_047330-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPC735_047330-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: Glycosyl hydrolases family 17 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	ACFW01000049|CGC21	31127.03	7.1660

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiC735deltSOWgp	7255	222929	26	7229

• Gene Location: location=ACFW01000049:918855-919800(-)

Full Sequence      

MQELAGFLAHLAFLLSIVLSGYEERAAAAGYFSGLGICYAPYTDGGQCKPQQEIDADFAK
LKKYQTIRIYGVDCNQVKMVLNTAKKNNSKVFAGIFNLKNFDGDLKSLISQAKDSWSNVA
AINIGNELVNRGLNSPDQVADAVKKARDILRGAGYQGPVVTVDTSGMLIKYPKLCHASDF
CAANAHAFFSSQTKAQDAGKFARNEADAVSKAAGGKFTVITESGWPSSGQPNGVAVPSPQ
NQNAAIESLKNSFKDRDGQLFLFSAFDDKWKQDFDGSFGGEKFWGIEE

Enzyme Prediction     

No EC number prediction in CPC735_047330-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	35	286	7.6e-26	0.954983922829582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.09e-70	28	286	39	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	5.97e-06	35	286	1	296	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS51160.1|GH17	5.31e-99	33	286	153	406
QSS63389.1|GH17	3.37e-98	33	286	134	387
QSS69160.1|GH17	4.27e-98	33	286	153	406
QKX63568.1|GH17	1.99e-94	36	288	164	414
BCS13276.1|GH17	1.21e-92	30	288	105	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.17e-17	48	279	49	280	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	7.82e-17	48	279	49	280	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	8.07e-69	23	286	115	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|P53334|SCW4_YEAST	2.18e-64	29	286	127	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q04951|SCW10_YEAST	2.06e-62	36	286	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|Q0CEX9|BTGE_ASPTN	1.38e-37	35	285	303	553	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	9.67e-36	30	285	303	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000860	0.999132	CS pos: 28-29. Pr: 0.8653

TMHMM  Annotations     

There is no transmembrane helices in CPC735_047330-t26_1-p1.