CAZyme Information: CPC735_043740-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPC735_043740-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: acetyltransferase, GNAT family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850		94007.98	7.3702

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiC735deltSOWgp	7255	222929	26	7229

• Gene Location: location=ACFW01000035:871239-873888(+)

Full Sequence      

MDNDELRRQLGQLFIVGFRSLIATDEVKSLIQAPYYCGTIILFQRNIESAEQLIALTNDL
QQTARDAGHTRPLFIAVDQENGLVTRIKPPIATQLPGAMALGATGYIDDAVRVSSATGEI
LDALGINMNYAPLCDVNSEPANPVIGVRSPGDDGTFVGRITSNIAKGLRKNNIVPCAKHF
PGHGSTKVDSHYGVPVVRKPKEDLEACELLPFRRAVAEGIEAIMTSHVVMSAFDDAGLPS
SVSKDVVNFLRRDLQHEGLIITDCLEMDAIRVQIGTEKGAVRALAAGVDCPMICHTYDVQ
VRALEEAFNACKIGTIPLRQISQSVSRVHALKDKFFDWGSVFRHRSVNTVTQLNLKHQEL
ANDIYARSVTVIRDDQKALPLSRGGSLVYVYPCGKALRVGASGSGETVTCVPYTPPEFSQ
ILKLFVPDLIECPFFDDATLDESTKSKISQADAVILASRNCRLNPSQRLIGTQLVNHSKK
LVSIATCVPYDFLNSGIKTCLAMYEPTVEAFQAAANVIFGVNEGVGKLPVCTKRPPLPID
SFDPERDMKLAINLWHMLLPHYAVPADRLHHLLDRPNGKHFTIYVEDQLAGFIATYVNED
RPTAYISVLLVHPKFRSRGVGTALVEHARRQLRGAARSVTIGSSFPRFFLGVPLDIPEEA
QNFFIHRGFVPTRGPSSRDYTADLRTYQPPEGVLQRAAAAGVTFTPWRINLYLECMANIR
ELWGDDEVWLGAYERLARQNRHEQVMVAMDRSGKQIGWTLMQELGLGMTNDLAFMPLLGQ
KTGQIGCLGIHPDARNKGVGLALVVSAAMDMKRRGLEKVFVDWTNHVNFYEKAGFEVWRE
YRSMTLKESV

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	71	292	3.2e-52	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	6.88e-71	6	390	3	359	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.85e-66	6	328	2	313	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.98e-44	24	331	14	305	beta-hexosaminidase; Provisional
395465	Acetyltransf_1	7.12e-11	560	669	15	116	Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.
404548	Acetyltransf_10	9.64e-11	564	672	17	110	Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM13647.1|GH3	0.0	1	850	1	850
BCR85716.1|GH3	9.69e-246	1	842	1	850
QQK41162.1|GH3	2.57e-245	1	842	1	848
CAP94355.1|GH3	3.31e-243	5	842	5	848
BCR93582.1|GH3	1.52e-240	6	846	6	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.22e-132	2	842	5	854	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	2.89e-82	6	529	13	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	5.50e-65	6	530	44	615	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.63e-64	6	530	18	589	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.02e-64	6	530	48	619	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	2.83e-64	6	530	44	615	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	3.34e-50	26	530	54	594	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|L7N6B0|LPQI_MYCTU	1.22e-34	7	332	62	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
sp|A0A0H3M1P5|LPQI_MYCBP	3.01e-34	7	332	62	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
sp|A1KSD9|NAGZ_NEIMF	4.36e-34	15	308	15	302	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) OX=272831 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CPC735_043740-t26_1-p1.