CAZyme Information: CPC735_023560-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPC735_023560-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: alcohol oxidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528	ACFW01000025|CGC2	58759.44	5.6569

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiC735deltSOWgp	7255	222929	26	7229

• Gene Location: location=ACFW01000025:386807-388622(+)

Full Sequence      

MASTQNEPKSYDYIVCGGGTAGCVVAGRLAEDPNITVLLVEAGQHNENLENVHMTGGWLN
NLDTEADWNIITPPMPGVNNRQVKLSRGKFLGGCSGVNGTLCVRGCKQDYDDWQLEGWSG
EEFFQYMSKAETFHPKPWFQASEGSHGSCGPLHIEPHDLAPISQRIMDSFVSKGLPYDAD
MFTTGETPHGCGHAPRTVYRGLRSTSADFVTKDCQRTNVTIKTDTIVDRILFEQDDKGAL
CAKGVVTIAADGTQQIFHADREVIVSGGAYCSPAILMRSGIGPKEELEKHGIRCEVDLPG
VGKNLMDHLIVFMFYETEKEGLTNDHLIYHGDAKEKSYALWKNHKTGFLSTFPFGAFAFA
RLDDRLADEPLWTQAKHEPGRDPMGLMPSQPNIEFFTTECYGGPKQYSKYPIDNKHAFSI
IAELFGPRSRGTVTLKSSDPRENPVVHCNYLDDPLDLLVLAEACRFANEIVMTGTGTKDI
VKGSWPPELTHHTYKTREEWVPYVKEHATTCEFLLLYLPKNLLVCPWN

Enzyme Prediction     

No EC number prediction in CPC735_023560-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	511	3.1e-131	0.8855633802816901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.14e-74	9	450	6	415	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.03e-72	9	450	4	414	choline dehydrogenase; Validated
274888	Rv0697	1.43e-44	12	471	2	396	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	4.27e-32	78	310	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.93e-18	2	319	47	338	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48130.1|AA3_2	6.91e-300	1	511	1	508
QMW36070.1|AA3_2	6.91e-300	1	511	1	508
UDD65288.1|AA3_2	4.62e-298	1	511	1	508
BCS07163.1|AA3_2	5.31e-294	9	511	3	503
QRD92967.1|AA3_2	2.60e-290	1	511	1	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU3_A	6.45e-69	7	489	3	489	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	6.45e-69	7	489	3	489	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	6.45e-69	7	489	3	489	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
2JBV_A	4.31e-45	9	496	12	460	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	4.31e-45	9	496	12	460	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	1.62e-58	9	510	3	466	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q66D54|BETA_YERPS	8.86e-56	11	510	3	470	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	8.86e-56	11	510	3	470	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|B2JS89|BETA_PARP8	1.35e-55	9	471	4	436	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=betA PE=3 SV=1
sp|A0A3B1EFP9|STR4_STRTC	2.05e-55	1	473	25	504	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000004

TMHMM  Annotations     

There is no transmembrane helices in CPC735_023560-t26_1-p1.