CAZyme Information: CPC735_017170-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPC735_017170-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605		68092.87	6.7089

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiC735deltSOWgp	7255	222929	26	7229

• Gene Location: location=ACFW01000043:1120934-1122953(+)

Full Sequence      

MPFLRFSRRKIIVALLTSCLLFLWSTQTALHKHTVFLPNANEKPVVVDDEPRRNSFSESN
NDQTIWARVPQRHPVRSMIPIPSPVPSSIPKIQHKFGEESSEARRVRTGRLDAVKGNFTH
AWRGYKTRAWMSDEVKPISGEAHNPFGGWAATLVDALDTLWIIGLHDEFEEAVQAIAKVN
FSRCALEEYSVFETTIRYLGGLLSAYDLSGEKYPSLLTKAIELGQMLYVAFDTPNRIPIT
HPNFIAAAKGAAQKPQDSALAAELGSLTLEFTRLSQLTNDPRYFDAAQRLMDIFEEHQSQ
TRIPGLWPVVINTRKLDFTRYGGFTIGGMADSLYEYLPKQHILLGGATKQYRKLYQNAMT
AIKRHILYRPMTKGGEDILLPGNVWADGNIPLSELKADGEAQHLGCFAGGMVAIGAKIFN
NPEEVDIARKLANGCVWAYETANQGIMPEIMHTVPCEDRDNCPWNETKWHEAVNRAYPFG
NVPAEQKIRAKNLPPGVTKIGDARYILRPEAIESVFVLYRVTGDPSFLEKAWKMFNAIVE
NTITDIAHAALDDCTLPDPPKADRMESFWLAETLKYFYLIFAEPDVVSLDEYVLNTEAHP
LKRSV

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	118	603	1e-168	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	118	603	2	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	6.54e-133	39	603	1	518	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	0.004	186	307	467	582	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM13103.1|GH47	0.0	78	508	1	431
APA15806.1|GH47	7.13e-263	50	603	37	590
CDF44004.1|GH47	1.01e-262	50	603	37	590
ATZ51000.1|GH47	1.01e-262	50	603	37	590
QGA20647.1|GH47	4.36e-262	61	605	42	584

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	4.57e-79	118	601	13	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	5.38e-79	118	601	18	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	5.69e-79	118	601	18	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KK7_A	2.69e-78	118	601	13	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	4.34e-78	118	601	96	532	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UKM7|MA1B1_HUMAN	8.03e-76	118	601	257	693	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|D4AV26|MNS1B_ARTBC	6.40e-75	113	602	43	506	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|P39098|MA1A2_MOUSE	2.67e-72	112	601	182	624	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|A2AJ15|MA1B1_MOUSE	1.42e-71	38	601	132	652	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|B2GUY0|MA1B1_RAT	1.01e-70	118	601	215	651	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.698326	0.301681

TMHMM  Annotations     

There is no transmembrane helices in CPC735_017170-t26_1-p1.