CAZyme Information: CPAR2_602650-T-p1

Basic Information

• Species: Candida parapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida parapsilosis
• CAZyme ID: CPAR2_602650-T-p1
• CAZy Family: GT39
• CAZyme Description: Ortholog(s) have alpha-1,6-mannosyltransferase activity and mannan polymerase complex localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431	Contig005504_C_parapsilosis_CDC317|CGC3	48952.36	9.5194

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CparapsilosisCDC317	5984	578454	147	5837

• Gene Location: location=Contig005504_C_parapsilosis_CDC317:631671-632966(-)

Full Sequence      

MRSLYRSASKLELHSDPPPVSHMPKYQTSSNNRGRKILIGTVLVSLVIITVAFFSGSLTP
AKDLQGVISSLPNDKLLGLSNFLSSENSKNQDELLSKIEKLNKKLFQAQEAKINKLEEQN
KLILQELKLLKTPPSSASIRDKLTYLYPFNSESKFPAYIWQSWKHGLNDERFDDKFRQGE
SQWAFKNPGFVHELFNDDTAHTVIKYLYSQIPEVIETFELLPEIIMKMDFFKYLILYAKG
GVYADIDTYPLQPIPNWTPENVSPLDIGMIIAIESDSSSPDWRKEQIRRLQFGQFVIQAK
PGHPILREAIAQIIEQTKVKKLESLAASGGGGPLRLIGNTNEKSLKISQWTGSAIWTDVV
LKYFNDYIQSSVFQKVTWKEFHKLQTPKLVSDVLVLPVKSFASDVEVSKDGKIEDPLAFV
KHYAAKIWKSG

Enzyme Prediction     

No EC number prediction in CPAR2_602650-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	178	260	1.3e-20	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.31e-38	100	425	27	343	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.53e-18	183	264	11	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE39846.1|GT32	1.80e-304	1	431	1	431
CCG24586.1|GT32	1.11e-258	23	431	1	408
ABN66691.2|GT32	1.44e-187	31	430	7	401
CCE86889.1|GT32	1.70e-171	33	430	6	399
CAG89506.2|GT32	1.96e-170	31	430	4	399

PDB Hits     

CPAR2_602650-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P47124|HOC1_YEAST	1.88e-100	61	430	38	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	7.53e-68	134	429	78	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	9.92e-50	138	429	79	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	4.83e-48	139	429	126	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999964	0.000056

TMHMM  Annotations     

Start	End
37	59