CAZyme Information: CPAR2_404930-T-p1

Basic Information

• Species: Candida parapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida parapsilosis
• CAZyme ID: CPAR2_404930-T-p1
• CAZy Family: GT15
• CAZyme Description: Alpha-1,6-mannosyltransferase activity involved in protein glycosylation, required for cell wall integrity and wild type virulence

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	Contig006372_C_parapsilosis_CDC317|CGC10	41448.31	6.9738

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CparapsilosisCDC317	5984	578454	147	5837

• Gene Location: location=Contig006372_C_parapsilosis_CDC317:1108655-1109743(-)

Full Sequence      

MGRRNYKTAFVTGFLLLVVYFFYFSFNGHAAYKTEPNSNKLQLIRELEANKEWKTRGFNF
QPKLKPTPEQSSKVLQELYHSIPYDPTSDFPKFIWQTWKVALSDESFPKRYRNFQKTWDD
KNPNYKHFVISDAQCDALVAELYAEAPDVAKAYSVMPKSILKADFFRYLILFARGGVYTD
IDTVGLKPIDEWASNNEEIAGKTNNAGLVVGIEADPDRPDWADWYARRIQFCQWTIQSKR
GHPMLAQLIAKITDITLTRSAKGQLKKILGKDEGGDIMNWTGPGIFTDYVFKYLNQVVEV
DWRLFTGMEQPIAIDDVLVLPITSFSPDVNQMGAKSSGDPMAFAKHMFSGSWKDDGMPEM
LT

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	110	195	1.1e-20	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.00e-46	72	355	64	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.77e-18	108	196	1	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE44689.1|GT32	7.41e-278	1	362	1	362
CCG25808.1|GT32	3.02e-252	1	362	1	362
CAX43101.1|GT32	2.80e-191	1	360	9	383
AOW28617.1|GT32	2.25e-188	1	360	9	383
AAL49987.1|GT32|2.4.1.257	2.25e-188	1	360	9	383

PDB Hits     

CPAR2_404930-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	4.00e-189	1	360	9	383	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	4.15e-92	34	355	55	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.30e-81	82	355	136	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	2.48e-65	43	354	76	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	3.57e-08	80	190	47	150	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000001

TMHMM  Annotations     

Start	End
9	31