CAZyme Information: CPAR2_400660-T-p1

Basic Information

• Species: Candida parapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida parapsilosis
• CAZyme ID: CPAR2_400660-T-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: Ortholog(s) have mannosyltransferase activity, role in GPI anchor biosynthetic process, fungal-type cell wall organization and glycosylphosphatidylinositol-mannosyltransferase I complex localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	Contig006372_C_parapsilosis_CDC317|CGC6	45834.29	9.0029

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CparapsilosisCDC317	5984	578454	147	5837

• Gene Location: location=Contig006372_C_parapsilosis_CDC317:143944-145137(-)

Full Sequence      

MVTLSGIIALAIVLRIGFFLFGLYQDEHMPVKYTDIDYLVFSDASRYVFQGQSPYLRETY
RYTPLLAMMLTPNNWGPAWCSFGKVLFMMGDLVTGVLIAKLLAKDKTLSKSKWLILSSLW
LLNPMVITISTRGSSESILTVLIMLSLYYLIEYGNILASAFWLGLAIHFKIYPIIYLPSI
LFYLTNSSQPIVNYPVIKLVNVRNIKYATYTIATLLLFNGLMYLLYGQEFLDHSYLYHIV
RIDHRHNFSVYNMVLYYKSALTTASSSTDIETLAFIPQLLLSGVIIPLIFAKKDLLSCLF
IQTFTFVTFNKVITSQYFIWFLIFLPHFLSKSNLLHTRRFHGIFVLTLWIVSQGCWLYNA
YRLEFLGENTLDYALFNSSLFFFLSNCICIGEFIKSL

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	129	394	5.6e-86	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.12e-81	1	395	5	416	GPI mannosyltransferase
252941	Mannosyl_trans	1.68e-67	129	394	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	1.36e-04	51	239	47	242	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE44265.1|GT50	5.09e-280	1	397	1	397
CCG23660.1|GT50	5.93e-238	1	397	1	398
AOW28981.1|GT50	1.44e-182	1	397	1	398
AAV03184.1|GT50	3.77e-182	1	397	28	425
CAX42079.1|GT50	4.65e-175	1	397	1	402

PDB Hits     

CPAR2_400660-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AMR5|GPI14_CANAL	2.57e-183	1	397	1	398	GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI14 PE=3 SV=1
sp|Q6BHI9|GPI14_DEBHA	1.41e-167	3	397	5	410	GPI mannosyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI14 PE=3 SV=2
sp|P47088|GPI14_YEAST	2.51e-107	6	397	7	389	GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI14 PE=1 SV=2
sp|Q4I073|GPI14_GIBZE	6.00e-102	5	395	11	406	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	4.55e-101	10	391	14	422	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000002

TMHMM  Annotations     

Start	End
2	24
75	97
138	157
162	184
205	227
274	291
303	325
340	362
375	394