CAZyme Information: CPAR2_200980-T-p1

Basic Information

• Species: Candida parapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida parapsilosis
• CAZyme ID: CPAR2_200980-T-p1
• CAZy Family: GH132
• CAZyme Description: Has domain(s) with predicted hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
906	Contig005809_C_parapsilosis_CDC317|CGC6	101118.02	5.0327

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CparapsilosisCDC317	5984	578454	147	5837

• Gene Location: location=Contig005809_C_parapsilosis_CDC317:183081-185850(-)

Full Sequence      

MKIINLVPFILLHSLIFSSEEVSFTLKSEFSNASNSHISNLHKRSRHAEQPIFVIEDSQD
YCSQVFYPSPLCGRVDNCWQNAFEKAKKVVEKMSIPEKVNLTTGTGWGSGPCVGNTGSVP
RLGIPNLCLQDGPNGVRFTDFVTHFPSGLATACTFNKGLSYLRGKAIGREHRKKGVHIAL
GPVIGPMGLKAQGGRNWESFGADPYLQGVLGAATVEGMQDEGVVATARHLIGNEQEHFRQ
VGEWDENGWEKLECSISSNIGDRAMHEIYLWPFANVIKAGVGSVMCAYNKVNNTYACENS
YLLNFLLKSELAFQGFVVSDWGAQHSGVGSALAGLDMTMPGEVYDDWLTGKSFWGPLLTR
AVYNGTVSQERLNDMVIRILMPFFAIDQVKLPTDEDIPNFSSWTRHTYGQLYPYQHSGPI
CQKNWHIDSRSDFSENTALTVAKESIVLLKNTYRHLPIDKSDGVRRLLIAGQGAGPDPEG
FNCKDQRCVGGVLTSGWGSAAVNNPYVITPYEAIAKKARERGIVVDYTSNNWDLENANDL
ADYADMSIVFVNAFSGEGYIHFDDNYGDRKNLSLWHNGDELISKIADRCHKTVVVVTSTG
PINMEKWIENENVVAVLFVAPLGQVVGQAIADVLFGDSNPSAKLPFTIAKKKQHYVSVVD
ELGENWEPQDNFDRDIYPDYRFFDKHNIKPRYEFGFGLSYTNFKVTNLKITEISPPSEFL
PYPQEYLPIQKMVEDDVCDAEDALFPHDEFEPSPGFIYPYLYNENIRSVDDDDTFEYPKG
FDPDQHSSPPLNAGGLGGNPALWEILYEVSAEVKNTGTMKGGYVSQLYIEFPSTIVSSPP
KVLRGFEKVFLEPGKSCKIFFNIMHRDLSIWDSESQQWIIQTGTYKIYLSSSSRKVELCG
EIDIGC

Enzyme Prediction     

EC	3.2.1.21:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	118	340	3.6e-61	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.13e-53	121	897	101	758	beta-glucosidase BglX.
224389	BglX	3.80e-48	120	495	56	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.47e-48	446	700	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.51e-40	85	863	52	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.62e-34	121	380	63	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE42455.1|GH3	0.0	1	906	1	906
CCG22951.1|GH3	0.0	1	906	1	906
AOW31603.1|GH3	0.0	1	906	1	924
CCE79815.1|GH3	0.0	73	905	40	871
CCE80580.1|GH3	0.0	73	905	40	871

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IIB_A	1.13e-234	63	898	6	833	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5NBS_A	1.35e-234	63	898	20	852	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5FJJ_A	1.65e-234	63	898	7	834	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5FJI_A	3.52e-234	63	898	6	836	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
6SZ6_A	2.17e-233	63	898	4	831	Chain A, Beta-glucosidase [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P22507|BGL2_SACFI	8.52e-303	56	886	33	862	Beta-glucosidase 2 OS=Saccharomycopsis fibuligera OX=4944 GN=BGL2 PE=3 SV=1
sp|P22506|BGL1_SACFI	3.91e-300	56	886	31	858	Beta-glucosidase 1 OS=Saccharomycopsis fibuligera OX=4944 GN=BGL1 PE=3 SV=1
sp|P87076|BGLA_ASPKW	2.93e-239	63	898	25	852	Beta-glucosidase A OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=bglA PE=1 SV=2
sp|A2RAL4|BGLA_ASPNC	7.49e-237	63	898	25	852	Probable beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglA PE=3 SV=1
sp|D0VKF5|BGLA_ASPTE	2.19e-236	63	902	26	857	Probable beta-glucosidase A OS=Aspergillus terreus OX=33178 GN=bglA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004005	0.995957	CS pos: 18-19. Pr: 0.9437

TMHMM  Annotations     

There is no transmembrane helices in CPAR2_200980-T-p1.