CAZyme Information: CPAR2_109880-T-p1

Basic Information

• Species: Candida parapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida parapsilosis
• CAZyme ID: CPAR2_109880-T-p1
• CAZy Family: GT91
• CAZyme Description: Ortholog(s) have N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase activity and role in dolichol-linked oligosaccharide biosynthetic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
197	Contig005569_C_parapsilosis_CDC317|CGC14	22187.31	5.5699

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CparapsilosisCDC317	5984	578454	147	5837

• Gene Location: location=Contig005569_C_parapsilosis_CDC317:2099929-2100522(-)

Full Sequence      

MSTILVTTGATVTFRQLIETVVSVKFVLSLIDLGVTKLLIQYGNEIKGSQHISRQFFESQ
LKKSNIIEKFGFTVENNTTNDTMMLTNNDIQITAFPFSPHIQDYINRADIIISHAGTGSI
IDTLRNHKRLLVVANNQLMDNHQEEIANEFVKMNYCAKCNCNDDFKSILASVQAHEFAKF
PESDGRILESIIAEELS

Enzyme Prediction     

No EC number prediction in CPAR2_109880-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227350	COG5017	1.71e-23	4	194	2	157	UDP-N-acetylglucosamine transferase subunit ALG13 [Carbohydrate transport and metabolism].
397977	Glyco_tran_28_C	5.94e-19	3	159	1	127	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.
223779	MurG	1.82e-05	76	156	221	301	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE40950.1|GT1	1.31e-134	1	197	1	197
CCG22798.1|GT1	7.38e-106	1	196	39	233
ABN67759.2|GT1	4.33e-52	1	196	1	210
SGZ50412.1|GT1	3.19e-47	4	195	3	201
SGZ51594.1|GT1	6.40e-47	4	195	3	201

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2KS6_A	4.29e-26	6	194	10	197	NMR solution structure of ALG13 --- obtained with iterative CS-Rosetta from backbone NMR data. [Saccharomyces cerevisiae]
2JZC_A	7.30e-26	6	194	33	220	NMR solution structure of ALG13: The sugar donor subunit of a yeast N-acetylglucosamine transferase. Northeast Structural Genomics Consortium target YG1 [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ABE5|ALG13_CANAL	1.32e-46	1	196	74	291	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG13 PE=3 SV=2
sp|Q6BST1|ALG13_DEBHA	9.46e-40	1	196	1	210	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALG13 PE=3 SV=2
sp|P53178|ALG13_YEAST	2.26e-25	6	194	11	198	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG13 PE=1 SV=1
sp|Q6CXY0|ALG13_KLULA	1.40e-21	2	150	3	148	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALG13 PE=3 SV=1
sp|Q6C3P1|ALG13_YARLI	2.70e-21	4	197	30	194	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG13 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999316	0.000708

TMHMM  Annotations     

There is no transmembrane helices in CPAR2_109880-T-p1.