CAZyme Information: CPAR2_106990-T-p1

Basic Information

• Species: Candida parapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida parapsilosis
• CAZyme ID: CPAR2_106990-T-p1
• CAZy Family: CE9
• CAZyme Description: Ortholog(s) have alpha-1,6-mannosyltransferase activity, mannosyltransferase activity and role in GPI anchor biosynthetic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	Contig005569_C_parapsilosis_CDC317|CGC10	46243.16	9.0799

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CparapsilosisCDC317	5984	578454	147	5837

• Gene Location: location=Contig005569_C_parapsilosis_CDC317:1489734-1490939(+)

Full Sequence      

MSQHPLRNLLRSFLTLKLIQLTIIYFTPSRFDTSSQLIIDELAISEYTASPYNAIITTIL
NKLITWDSVYFNDLFVNDVAFEHQFVFCPGWIKMISKLPSDNYYQLQLWSILISNCCHLV
SVLVLYSLSKMVFDSKVSYIASLMMVVAPAGVFLTTNYSENLSNLTTLLTIYLYYKAVNF
NNVTTKSNKSIKSMGVYCLSGVVCAFSFTIRANSLLVGIFYLLDLYDFSIIDQDWKTSIQ
SIITGSILGSTFIGQNIHHYRTFCPQRQGWCLNKFPSLFQYAQSHYWSNGFLSYWTLNNV
PNFILVAPVLLWNIYSVKSAWKLLPQYRKLLPLVVLNGMIIIGGVFFWNVQILNRITSFS
PLIYWQLAFDYNKPWFKYILGYILTWNLIQTALFAAFLPPA

Enzyme Prediction     

No EC number prediction in CPAR2_106990-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	10	401	2.5e-91	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.48e-40	9	401	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.48e-15	13	401	7	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].
404170	PMT_2	2.05e-04	92	182	10	97	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE40664.1|GT76	2.30e-294	1	401	1	401
CCG22525.1|GT76	2.81e-243	1	401	32	432
AOW26102.1|GT76	6.90e-169	8	401	4	394
CAX44663.1|GT76	3.51e-159	8	401	77	485
ABN67789.1|GT76	9.63e-122	5	401	5	394

PDB Hits     

CPAR2_106990-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59VN0|GPI18_CANAL	1.23e-169	8	401	4	394	GPI mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI18 PE=3 SV=1
sp|Q6BRZ9|GPI18_DEBHA	2.07e-102	9	401	7	428	GPI mannosyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	5.56e-52	13	401	11	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q6CMW6|GPI18_KLULA	7.28e-48	12	401	16	417	GPI mannosyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI18 PE=3 SV=1
sp|P38211|GPI18_YEAST	1.05e-46	13	401	9	433	GPI mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI18 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.937419	0.062592

TMHMM  Annotations     

Start	End
103	125
137	156
166	183
196	218
295	317
330	352
378	400