CAZyme Information: CPAR2_106340-T-p1

Basic Information

• Species: Candida parapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida parapsilosis
• CAZyme ID: CPAR2_106340-T-p1
• CAZy Family: CBM21
• CAZyme Description: Ortholog(s) have 1,3-beta-glucanosyltransferase activity and role in ascospore wall assembly

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571	Contig005569_C_parapsilosis_CDC317|CGC7	65014.81	4.6843

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CparapsilosisCDC317	5984	578454	147	5837

• Gene Location: location=Contig005569_C_parapsilosis_CDC317:1360981-1362696(-)

Full Sequence      

MTRVVNQNEKDSFPLYPIKIVGNKFYNSGTKEQFFIKGIAYQKSREEGEVFDTTTETNYI
DPLANPFTCLRDLEYLKELGVNVVRIYQVNPNANHDVCMEAFAEAGIYILADLSEPYVSI
RRDFPRWDSELLIRYRSVVDALSKYDNVLGFFAGNEVANSQSNIDAVPFVRSAVRDVKQY
IHDQGYRQIPVGYASNDDASIRANLANYFVCDLNDEYSQSDFFAINVYEWCGYSTYMTSG
YRELTAVFANYPTPVFFSEFGCNIITPRPFTEVEALFGSTMRKTWSGGIAYEYFEEINHY
GVVQNKKDGTIAKLPDFETLKTRFNAVNPIGLPIDEVQERPKLTCSEPSDIWKVSLELPP
TPDFGKCECLWQSLSCVVVDTGSFDEESLLKDLCFKVDCDEINANGRLGRYGKYSDCNPM
IRVSYALNKYYEQTGKRKDICTFQGRGEIARLSVDLNTMFSTDGRNCQTLLNDADHEEAP
QVDNNKLEDEAEADDEMGANEDDNEEQYTKTPEDHKKPRSKKATKDVSKKRNSKPVTTPS
RKVTSNASTLALPFERFFKRISHLIFLGSPI

Enzyme Prediction     

EC	2.4.1.-:30	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	16	326	7.2e-127	0.9775641025641025

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	3.33e-154	17	327	11	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	4.02e-20	374	447	1	75	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	2.99e-10	374	449	1	73	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
225344	BglC	0.002	72	264	78	325	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE40599.1|CBM43|GH72	0.0	1	571	1	571
CCG22464.1|CBM43|GH72	0.0	3	564	18	573
CAX44480.1|CBM43|GH72	8.14e-240	18	478	60	549
ABU33902.1|CBM43|GH72	7.62e-239	18	481	55	542
AOW25920.1|CBM43|GH72	6.19e-238	18	481	55	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.43e-148	18	441	36	466	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	4.05e-148	18	441	36	466	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	4.05e-148	18	441	36	466	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59VW6|PGA5_CANAL	1.10e-238	18	481	55	542	1,3-beta-glucanosyltransferase PGA5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PGA5 PE=1 SV=2
sp|Q06135|GAS2_YEAST	7.37e-148	18	441	36	466	1,3-beta-glucanosyltransferase GAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS2 PE=1 SV=1
sp|O13318|PHR2_CANAL	2.79e-136	18	449	28	452	pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR2 PE=2 SV=2
sp|O74137|EPD2_CANMA	3.26e-136	17	449	28	464	Protein EPD2 OS=Candida maltosa OX=5479 GN=EPD2 PE=3 SV=1
sp|P22146|GAS1_YEAST	5.01e-135	18	449	28	453	1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CPAR2_106340-T-p1.