CAZyme Information: CPAG_09741-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPAG_09741-t26_1-p1
• CAZy Family: GT76
• CAZyme Description: mannan polymerase II complex ANP1 subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		46450.01	6.8715

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiRMSCC3488	10016	454284	119	9897

• Gene Location: location=DS268114:2898263-2899810(+)

Full Sequence      

MLLPKGGITWKSTQAKLAPWRAVLGALSRPRFILTAAIMGLIVLLWRGISHSASEMQSFY
CFGPSKPPHKMTANEMVDWHAHLQTPVLFNHHEPYEINSTTVQTVDLNAVHSTPKAVQNK
ERVLILTPLRDASQYLGKYFDLVSELTYPHDLIDLAFLVGDSKDDTLAVLAAELDRVQGM
PGKIPFRSATIVQKDFGVTLDMNVQEKHGYEAQAPRRKAMGKARNFLLSATLKPEHSWVY
WRDVDIVDSPKKIIEDFVAHDKDILVPNIWFHRYDENGRDIEGKFDYNSWIESDKGRKLA
STLDKDTILVEGYKEFDTGRTYLVSMGDWRKNKDEEVELDGIGGVNIIVKADVHRAGINF
PCYAFENQAETEGFAKMAKRAGYQVVGLPNYVVWHIDTEEKGGNLGGRKAY

Enzyme Prediction     

No EC number prediction in CPAG_09741-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	100	363	5.2e-105	0.9850746268656716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	3.32e-160	101	364	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX56390.1|GT62	2.73e-243	1	411	1	411
QSS51499.1|GT62	9.37e-239	1	411	1	409
QSS69525.1|GT62	1.89e-238	1	411	1	409
QGA13607.1|GT62	2.03e-238	1	411	1	411
CAK38583.1|GT62	4.55e-235	1	411	1	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	9.12e-69	106	399	10	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	4.71e-92	88	396	48	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	5.60e-91	120	396	97	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	2.23e-77	100	396	170	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	5.27e-75	96	396	70	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P39107|MNN9_YEAST	5.10e-69	88	399	82	393	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000006

TMHMM  Annotations     

There is no transmembrane helices in CPAG_09741-t26_1-p1.