CAZyme Information: CPAG_07710-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPAG_07710-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: Gcs1-prov protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
818		92280.09	5.0813

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiRMSCC3488	10016	454284	119	9897

• Gene Location: location=DS268113:1069324-1072153(-)

Full Sequence      

MRGVSQSLWISALAILSINDSVNAHAKCTTLEPPTLNDGTHHASNESLLWGPYRPNLYFG
VRPRVPKSLLMGLMWAKVDEYSSAQGNFRHTCEQNEGMAGYGWDEYDIRKGGRQTIHDAG
NTLDLTIDFIKVPGGSHGGSWGARIKGQPRPDAPPDQPTTMIFYAAMEGLGKLGVANEGD
PLGFKDNVKLSGGTMELGEFTIDITRGPDTNSHPPNTHPSHDVKPLDRSFVASLQLQPDL
LWQAKSILFAHMKQEVDPLIRKYGTENPPPPSRYFTIANGPGHGNFHMVQKVFQGAFEFD
ILFSSGSAGQPLTSDVLTKEIETTAQAFEDKFKEIYSPMKPFDSPKYLPFSKAMLSNLVG
GVGYFYGDSIVDRSNAPEYDEEDEGFWEGTAEARARAKLLPSDPAELFTSIPSRPFFPRG
FLWDEGFHLMPIVDWDLDLGLQIVKSWFNLMDDDGWIAREQILGPEARSKVPPEFQVQYP
HYANPPTLFMILEDLVDKMEAGISTSGSDAASGICSKDLEAAKAYLRSLYPLLKRQYFWF
RKTQWGDIKSYDREAFSTKEAYRWRGRTVELVLTSGLDDYPRAQPPHPGELHVDLISWMG
LMTRSLRRIAGALGETEDVDEFGKYENAIKRNIDDLHWDEAKKTYCDATIDEFEESVHVC
HKGYISLFPFLTRMLEPDSPRLAHILDLISDPEELWSEYGIRSLSKKDELYGTGENYWKS
PIWININYLILKNLLDLATAPGPYQKQASEMYTKLRKNVVDNVFNEWKRTGFAWEQYNPE
TGHGQRTQHFTGWTSLVVKMMAMPDLSAGSTEAVRDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	590	801	4e-33	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	312	803	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	3.62e-129	48	270	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	8.69e-05	523	755	358	565	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
215307	PLN02567	0.006	593	647	328	382	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM12625.1|GH63	0.0	1	818	1	818
QSS68976.1|GH63	0.0	15	808	12	809
QSS63216.1|GH63	0.0	15	808	12	809
QSS50985.1|GH63	0.0	15	808	12	809
QRD84190.1|GH63	0.0	43	818	35	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	3.06e-171	44	801	11	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	3.45e-147	9	802	4	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	1.12e-237	43	802	37	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	3.01e-170	44	801	41	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	1.58e-148	9	802	59	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	9.47e-147	9	802	59	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	7.61e-138	33	802	78	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000282	0.999691	CS pos: 24-25. Pr: 0.9699

TMHMM  Annotations     

There is no transmembrane helices in CPAG_07710-t26_1-p1.