CAZyme Information: CPAG_06856-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPAG_06856-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: chitin synthase 8

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1491		164539.83	7.8643

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiRMSCC3488	10016	454284	119	9897

• Gene Location: location=DS268112:2115816-2120619(+)

Full Sequence      

MAAAPSHAQSSLPSLPHHLQSDTQLTAHLASRFHVSLPTARLSSHALICLNTYTSSTKGP
DGLKEGSAMGEAEDLARRAWTRLGSRGENQAVVFLGESGSGKTTIRSHLLSSLLSFTSTP
LSTKLSLAAFVFDTLTTTKAVTTPTASKAGLFFELQYDASSTVNPTLIGGKLLDHRLERS
RIASVPTGERSFHVLYYLLAGTSPAEKTHLGLSSSGDVISSGPTKRSSSQASHKRWRYLG
HPTQLKVGINDAEGFQHFKTALRKLEFPRSEIAEICQILACILHIGQLEFTTGQATRTGA
DESGGYSHEGGETITVVKNKDVLSIVAAFLGLSVDELETSLGYKTKTIHKERVTVMLDPQ
GARTNADGFARTLYALLVAYVIENINQRICAAEDAVANTISVVDFPGFAQMSTTNSTLDQ
LLNNAATESLYHYCLQNFFERQADMLETEEVNVPATSYFDNSDAVKGLLKHGNGLLSILD
DQTKRARTDLQFLESIRKRFENKNPAIAVGSSTAILPGSNFATQNAAAVFTVRHFAGEVD
YPVKGLIEENGDLVSGDLLNLISSTKSGFVRELFGQEALQTIHHPKERNAIMQAQVSSKP
LRMPSMARRKMSRPSRFTSFGSQSEADDTDDFASTSTSTKKGGSNSKKGSVAGAPKQGAA
GQFLASLDNITKSLSASNVNPYFVFCLKPNDRRIANQFDSKCVRTQVQTLGIAEISQRLR
NADFSVFLPFAEFLGLAEAESIIVGSDKEKSQLIVDEKRWPTNEARVGSTGVFLSERCWA
DLAKVGERVLPSFSGEGTDDGRDGLLHVGGNQYGDSKVRLLPSGDSTPGAFIYGDDKQGY
FGSRELDARSDAGASAFNSGDMFKNLETREQMAERSNEKEMVEVEDVIVSGSRKRWLALV
YLLTFYIPDFLIKWVGRKKRKDVRVAWREKFAINLLIWLSCGFVVFFIILFPRLICPTQH
VFSAEELSSHDGKGNHNAYTAIRGEVFDLGSFIPAHYPGIVPRSALIKYAGIDATHLFPV
QVSALCRGKGGSQRPIDPSVLFDFTPTNISGSANVVSGNDKNFLYHDFRHFRNDTRPTWY
FQQMRYLRANYKKGEIGYTKSHLKTLAEKESQYIGVINGVVYDFTDYMIGGRITRDKDGK
PKPGVDVDFMDSRVVDLFQQKSGHDLTEYFNRLPLSSTLRYDMEVCLNNLFKVGALDTRN
STQCLFSQYFVLACSALLASIIGFKFLAALQFGRKNVPENLDKFIICQVPAYTEDEESLR
RAIDSMARMKYDDKRKLLVVICDGMIIGQGNDRPTPRIVLDILGVPETVDPEPLSFESLG
EGMRQHNMGKVYSGLYEVQGHIVPFLVVVKVGKPSEVSRPGNRGKRDSQMLLMRFLNRVH
YNAPMSPLELEMHHQVRNIIGVNPTFYEFILQVDADTVVAQDSATRMVASFLHDTRVIAL
CGETALNNAKSSMITMIQVYEYWISHNLTKAFESLFGSVTCLPGCFTPSKI

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	1220	1487	1.8e-120	0.5313092979127134

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
276845	MYSc_Myo17	0.0	20	782	1	645	class XVII myosin, motor domain. This fungal myosin which is also known as chitin synthase uses its motor domain to tether its vesicular cargo to peripheral actin. It works in opposition to dynein, contributing to the retention of Mcs1 vesicles at the site of cell growth and increasing vesicle fusion necessary for polarized growth. Class 17 myosins consist of a N-terminal myosin motor domain with Cyt-b5, chitin synthase 2, and a DEK_C domains at it C-terminus. The chitin synthase region contains several transmembrane domains by which myosin 17 is thought to bind secretory vesicles. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
214580	MYSc	1.10e-159	9	787	11	677	Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
367353	Chitin_synth_2	8.58e-145	1220	1491	2	286	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
276950	MYSc	3.55e-84	75	775	60	633	Myosin motor domain superfamily. Myosin motor domain. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
395017	Myosin_head	6.37e-67	75	773	71	672	Myosin head (motor domain).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAR88368.1|GT2	0.0	1	1491	1	1491
AAQ05979.1|GT2	0.0	1	1491	1	1491
QSS57527.1|GT2	0.0	3	1491	11	1495
ABV31247.1|GT2	0.0	5	1491	11	1493
QSS67452.1|GT2	0.0	3	1491	11	1498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I0H_A	2.02e-47	75	784	136	736	Crystal structure of myosin X motor domain in pre-powerstroke state [Homo sapiens],5I0H_B Crystal structure of myosin X motor domain in pre-powerstroke state [Homo sapiens]
5I0I_A	3.36e-47	75	784	134	734	Crystal structure of myosin X motor domain with 2IQ motifs in pre-powerstroke state [Homo sapiens],5I0I_B Crystal structure of myosin X motor domain with 2IQ motifs in pre-powerstroke state [Homo sapiens]
5KG8_A	2.02e-45	75	784	134	734	Rigor myosin X co-complexed with an actin filament [Homo sapiens]
4A7F_C	3.10e-44	28	774	32	679	Structure of the Actin-Tropomyosin-Myosin Complex (rigor ATM 3) [Dictyostelium discoideum],4A7F_G Structure of the Actin-Tropomyosin-Myosin Complex (rigor ATM 3) [Dictyostelium discoideum],4A7F_J Structure of the Actin-Tropomyosin-Myosin Complex (rigor ATM 3) [Dictyostelium discoideum],4A7H_C Structure of the Actin-Tropomyosin-Myosin Complex (rigor ATM 2) [Dictyostelium discoideum],4A7H_I Structure of the Actin-Tropomyosin-Myosin Complex (rigor ATM 2) [Dictyostelium discoideum],4A7H_J Structure of the Actin-Tropomyosin-Myosin Complex (rigor ATM 2) [Dictyostelium discoideum],4A7L_C Structure of the Actin-Tropomyosin-Myosin Complex (rigor ATM 1) [Dictyostelium discoideum],4A7L_G Structure of the Actin-Tropomyosin-Myosin Complex (rigor ATM 1) [Dictyostelium discoideum],4A7L_J Structure of the Actin-Tropomyosin-Myosin Complex (rigor ATM 1) [Dictyostelium discoideum]
1LKX_A	1.32e-43	28	774	32	679	Motor Domain Of Myoe, A Class-i Myosin [Dictyostelium discoideum],1LKX_B Motor Domain Of Myoe, A Class-i Myosin [Dictyostelium discoideum],1LKX_C Motor Domain Of Myoe, A Class-i Myosin [Dictyostelium discoideum],1LKX_D Motor Domain Of Myoe, A Class-i Myosin [Dictyostelium discoideum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4P9K9|CHS8_USTMA	4.46e-317	29	1491	25	1513	Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS8 PE=3 SV=1
sp|J9VNT4|CHS5_CRYNH	2.83e-284	75	1491	101	1501	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|J9VF17|CHS4_CRYNH	1.52e-171	878	1491	148	754	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|O13395|CHS6_USTMA	1.01e-160	884	1491	61	655	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|O13356|CHS1_CRYNH	1.53e-63	896	1491	75	713	Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

Start	End
896	915
935	952