CAZyme Information: CPAG_06210-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPAG_06210-t26_1-p1
• CAZy Family: GH92
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	DS268112|CGC1	60191.52	6.4325

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiRMSCC3488	10016	454284	119	9897

• Gene Location: location=DS268112:396955-398811(+)

Full Sequence      

MPAKTTTELPVGDVDNYDYVIVGGGTAGCVIASRLAEYLPRMKILLVEGGPSDFMDDRVL
LLKDWLNLLGGELDYDYGTTEQPMGNSHIRHSRAKVLGGCSSHNTLISFRPFEYDCKRWE
SKGCTGWSFETFSRVLDNLRNTVQPVHARHRNQLCKDWVNACSSAFDIPVIEDFNKEIRS
TGKLTEGVGFFSVSYNPDDGRRSSASVAYIHPMLRGEEHKPNLTVLTDAWVSRVNVSGDT
VTGVNVTLQSGTKLTLRPKRETIICAGAVDTPRLLLLSGLGPREQLSSLNIPVVKDIPGV
GENLIDHPESIIIWELNQPVPPNQTTMDSDAGIFLRREPPNARDFDGDAADVMMHCYQIP
FCLNTARLGYDTPTNAFCMTPNIPRPRSRGRLYLTSSDPNVKPALDFRYFTDPEGYDAAT
IVYGLKMARKVAQQSPFKEWIKREVAPGPNLTTDEELSEYGRRVAHTVYHPAGTTKMGDV
TRDPMAVVDPQLKLRGLKNVRIADAGVFPDMPTINPMLTVLAIGERAAELIAQEAGWKGA
APRL

Enzyme Prediction     

No EC number prediction in CPAG_06210-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	15	538	1.5e-89	0.511326860841424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.19e-109	16	536	7	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.19e-107	17	531	6	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.37e-42	386	527	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.91e-34	2	524	41	569	Protein HOTHEAD
366272	GMC_oxred_N	4.42e-25	93	309	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS03844.1|AA3_2	0.0	5	544	92	631
BCS15458.1|AA3_2	0.0	5	544	3	542
CAK47101.1|AA3_2	0.0	5	544	3	542
EAA64559.1|AA3_2	0.0	5	544	3	542
ATQ35968.1|AA3_2	0.0	5	544	3	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	4.84e-122	17	531	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	6.84e-122	17	531	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.92e-121	17	531	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7AV4_AAA	9.46e-54	17	542	84	649	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	1.45e-53	17	542	8	573	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	2.49e-121	17	531	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	7.10e-73	15	532	5	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q6G664|BETA_STAAS	5.79e-68	16	531	7	536	Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=betA PE=3 SV=1
sp|Q8NUM0|BETA_STAAW	5.79e-68	16	531	7	536	Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=betA PE=3 SV=1
sp|Q9WWW2|ALKJ_PSEPU	7.77e-68	17	534	2	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000006

TMHMM  Annotations     

There is no transmembrane helices in CPAG_06210-t26_1-p1.