CAZyme Information: CPAG_05684-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPAG_05684-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
909		101659.99	5.7769

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiRMSCC3488	10016	454284	119	9897

• Gene Location: location=DS268111:2910980-2914163(-)

Full Sequence      

MFWRSAKSDNLESTQPSAQVSTANVSPRLSGCSSAQGTASRPFSQSENRMTIAGIDEDSK
YRAIIKYLHARLATNQWYSLPTDPTVEYHGLLLRKSRGSYISEPENVHPLLLAAVQKINV
SVAFTMSTETTRIILSLLQQNQTELVLPNGFQVQVIDSLADIACSPSSSVKKFQYVAFIR
EEGFLLVWHDELDKILLHAEDVESKLLSFICGTSTSVFASSIPRYPLQRSPLHSAANSTH
QFTTRRSKEAGDVVNQTSSAPDEEAANPVESLDRPVALTSSIFVGLGSCLIIVLILGFGV
SNLVLQVLVDGKWTRLGLLATIPVFMLFSVFFVIVIFTDIFQAIGPIKTLKTNSRFYSAL
RPDLAQAYSLGFKPPRLTIQMPVYTESLNGVIIPTITSLKAAISHYESHGGAATIFVNDD
GLAYLSEEEREDRINYYHDNNIGWVARPRNNEDGYIRKGKFKKASNMNFALNISNKVEDK
LLEMLSETLETTDMVDVGREELFYQLALEEVLASDSRVKAAGDIRIGEAILIVDSDTRVP
VDCLLYGAAEMFLNPEVAIIQHSTGVMQVSEDYFENGITFFTNLIYSAIRFAVGSGETAP
FVGHNAFLRWQAVQSVGKQDDGYVAYWSESHVSEDFDIALRLQIAGNIVRLASYHGDEFK
EGVSLTIYDELARWEKYAYGCNELVFNPIYTWIYKGPFTRLFMTFLWCNLQLSSKITILG
YISSYYALASGFPLTVMNYFLVGWLNGSLDKFYLESWKVFLGLILVFPLLGNICLAIIRY
RLAEKSLWGALLENFKWAPMMAIFFGGISFHISLAILSQMFRVNMEWGATAKEKVDSNFF
KEMPKIFKSFKWMYAVVLPLIGGMVYLGCFAPRGWEITEIAAVVPLSVTLASHALLPLLL
NPSLMIFNY

Enzyme Prediction     

No EC number prediction in CPAG_05684-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	530	740	4.4e-55	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	4.71e-53	530	742	2	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.87e-10	527	833	138	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	3.77e-09	527	635	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224137	GT2	5.91e-04	528	724	86	283	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18667.1|GT0	0.0	34	909	36	919
QRD03074.1|GT0	0.0	55	909	3	858
CBX97842.1|GT0	0.0	49	909	47	904
CAE7220538.1|GT0	0.0	55	909	53	907
CAC28725.2|GT0	0.0	57	909	142	1003

PDB Hits     

CPAG_05684-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CPAG_05684-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

Start	End
282	304
316	338
725	747
760	782
797	817
853	875
880	902