CAZyme Information: CPAG_05154-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPAG_05154-t26_1-p1
• CAZy Family: GH36
• CAZyme Description: acid trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1135	DS268111|CGC9	124013.79	5.1318

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiRMSCC3488	10016	454284	119	9897

• Gene Location: location=DS268111:1469033-1472713(-)

Full Sequence      

MFANTLCAGLLFTGQVLGVAHSHGSKASKILDRNILSQRLDKRESNIQAPLYPTKFSGVT
WDNTNWRLTTTVLDQGHYQSRGSIANGYLGISVAAVGPFFELDVPVNGDVINGWPLFSRR
QTFATISGFHDLQPETNGTNFPWMNQYGGESVISGVPHWSGMILDLGQDGYLDASVENST
ISDFVSTLDMKAGTLTWKYKWTPAGRNDSFDIAYQLFAHKLHVNQAVVHMEITPSTNIDA
TIVNILEGYSAVRTQFAGSGTDGQAIYSSVRPDGISNVTAYIYAQMAGTDEVDMSTLSLV
TDKPYIRRNDSTIAQAVSVRLRAGVTTGVTKFVGAASTDGFADPRLVAKDSCAKALNNGF
ETSLRSHIGEWAIVFPDDSVDNFSLPDTGHLPLDNHIIESAITAVANPYYLLQTTVSTNA
RKAVNDAPINRGSMAVGGLTSDSYAGLVFWDADIWMQPGFVPAFPEAAQSFTNYRVDKYG
QALANAQTAFTSSKNRTHISPDAAIYSWTSGRFGNCTGTGPCFDYQYHLNGDIGLQLINN
WVTTGDTEYFKSDLFPLYNSIATLFADVLERNGSKWTLTNMTDPDEYANHVDAGGFTMPM
IASTLIYANSFRQMFGLEQNQTWNDMAENVLISRDPSSSITLEYTTMNGSTQVKQADIVL
NTFPLRYTENYSPENALLDLDYNLQYAAKQSPDGPAMTYAIFSIVANEVSPSGCSAYTYA
QYSFSPYVRAPFFQFSEQLVDDWLTNGGTHPAFPFLTGKGGANQVVLFGYLGYRLLPDSV
LHIDPNLPPQIPHINYRTFYWHGWPIKAESNYTHTTIRRAQHRTALPTADQRFADAPIPV
HVGPESNVTVYSLPPSGDLVIQNRQIGSIDTFPGNLVQCQPVSSPHEYLPGQFPIAAVDG
AASTKWQPTRANMTASLTVTFPESALSSSISGFGFDWAQAPPQNAKVLLHDFPLPPVLDI
FAESPPGSIVVADLSEIAVSDPYKPNVTDLNKIMRYKGNTTNVTLSSPVPVTKFATLLIS
GNQGLGDAEIKAGNGTGATVAEWSILGAGGLGSNGREDKPAVNKFRIRGVPWTNKRFSPI
AHVTEDCLTDSSKAKLEDYYIDLLHPWCFNEHGLEVKSSLLTERRFLDAPTARDG

Enzyme Prediction     

EC	3.2.1.28:5	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	408	775	2e-75	0.9811827956989247

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224471	ATH1	4.76e-59	65	797	10	725	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
397616	Glyco_hydro_65N	5.31e-42	74	338	9	240	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.
281612	Glyco_hydro_65m	5.06e-18	407	723	3	345	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS73854.1|CBM32|GH65	0.0	45	1072	49	1091
QSS66944.1|GH65	0.0	45	1069	49	1088
UKZ51236.1|GH65	0.0	46	1063	45	1060
UKZ77068.1|GH65	0.0	46	1063	45	1060
QYS98630.1|CBM32|GH65	0.0	26	1047	29	1043

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	6.96e-37	66	772	24	639	Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	1.36e-14	433	803	326	722	Crystal structure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	2.19e-11	413	808	295	713	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	4.96e-11	413	808	295	713	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B5H9|ATC1_ARTBC	0.0	43	1046	44	1051	Cell wall acid trehalase ARB_03719 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03719 PE=1 SV=1
sp|P78617|TREA_EMENI	0.0	52	1047	50	1038	Acid trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treA PE=3 SV=1
sp|Q5AAU5|ATC1_CANAL	2.38e-125	78	947	121	964	Cell wall acid trehalase ATC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATC1 PE=1 SV=2
sp|P48016|ATH1_YEAST	7.27e-113	19	947	75	1034	Periplasmic acid trehalase ATH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATH1 PE=1 SV=1
sp|N1P212|ATH1_YEASC	7.27e-113	19	947	75	1034	Periplasmic acid trehalase ATC1 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) OX=889517 GN=CENPK1137D_1727 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.377413	0.622597	CS pos: 22-23. Pr: 0.3480

TMHMM  Annotations     

There is no transmembrane helices in CPAG_05154-t26_1-p1.