CAZyme Information: CPAG_03960-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPAG_03960-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204		22832.00	5.2511

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiRMSCC3488	10016	454284	119	9897

• Gene Location: location=DS268110:2891842-2892589(+)

Full Sequence      

MPPIPESHGNSTLTNPRVICYYQTYYPNNGTDYISTLPLLTNDCGVSHIILAAIHINDEP
GNITLNDHSPDDPRYVPLWAEMRVMQASGTKVMGMVGGAAKGSYQRLDGSVADFEAFYCP
LRDMIRTRNLNGLDLDVEEDMSLDGIIRLIDRLKSDFGDEFIITLAPVATAMVRGLRHLS
GFDYRALETARGSKISWAMFQWKR

Enzyme Prediction     

EC	3.2.1.96:2

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119363	GH18_CTS3_chitinase	2.28e-115	17	197	1	180	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119349	GH18_chitinase-like	1.05e-17	18	169	1	150	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	8.99e-09	27	175	11	162	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
214753	Glyco_18	0.002	17	169	1	157	Glyco_18 domain.
119360	GH18_PF-ChiA-like	0.005	37	190	17	164	PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain. Members of this domain family are found not only in archaea but also in eukaryotes and prokaryotes. PF-ChiA exhibits hydrolytic activity toward both colloidal and crystalline (beta/alpha) chitins at high temperature.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO88269.1|GH18	5.68e-144	1	197	1	197
QVM11529.1|GH18	5.68e-144	1	197	1	197
QSS58282.1|GH18	1.89e-90	1	197	1	194
QYS94730.1|GH18	4.76e-79	1	197	1	193
QYS94729.1|GH18	9.30e-79	1	197	1	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8V_A	3.29e-79	1	197	3	192	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]
4AC1_X	2.51e-47	16	197	3	185	Chain X, ENDO-N-ACETYL-BETA-D-GLUCOSAMINIDASE [Trichoderma reesei]

Swiss-Prot Hits     

CPAG_03960-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995380	0.004647

TMHMM  Annotations     

There is no transmembrane helices in CPAG_03960-t26_1-p1.