CAZyme Information: CPAG_03561-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPAG_03561-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: GPI mannosyltransferase 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	DS268110|CGC2	59748.16	9.0856

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiRMSCC3488	10016	454284	119	9897

• Gene Location: location=DS268110:1901581-1903501(-)

Full Sequence      

MWRRTYLILLVIRIYFALSPSYLHPDENFQGPEIFAEQVYSYPAHLTWEFTSSKPIRSIF
PLWLSYGLPMTVLKWFWTETGSGSTPPYLIYYVLRGTMFGLSFVLEDWAIHELITSPRHR
REAVVLVASSYVTWTYQTHTFSNSLETLLVAWSLVVIQRILENRVGFTSMRAQNSPWVVT
TPFAFVSLALSGIIFSLVAIYADTSFYSSSPVSISDIFRKPIITPLNNLLYNSDKTNLAS
HGLHPHYQHFLINAPQLLGPVYVLLIASIFSRSSRSNFSLLNMRALSALTGTLILSVFPH
QESRFLIPCVPLLLTCFRLPNPRVFLVTWIAFNSIMGLLLGVYHQGGIIPAQLQIPTIIS
NLNPGLEKGPASQETANVFWWKTYSPPLWLLGDAANITIKTHDLMGIPGRDMLEKLRKTI
PRCSDGSILRYPRFSGSKSNNDRRVVNPTLLVAPNSATFLDQYVRSENKDESQDDRLSLQ
LDPLWRYDCHLHLDDMDFGDDGILPTLKRVVGRRGLNVWLVTRACG

Enzyme Prediction     

EC	2.4.1.-:4	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	390	3e-69	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	6.13e-43	5	389	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
350723	DEADc_MRH4	0.003	79	233	69	223	DEAD-box helicase domain of ATP-dependent RNA helicase MRH4. Mitochondrial RNA helicase 4 (MRH4) plays an essential role during the late stages of mitochondrial ribosome or mitoribosome assembly by promoting remodeling of the 21S rRNA-protein interactions. MRH4 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM11889.1|GT22	0.0	1	526	1	552
QSS72479.1|GT22	1.24e-211	1	523	1	617
QSS55894.1|GT22	5.02e-211	1	523	1	617
QQK45046.1|GT22	2.70e-203	1	525	1	522
QGA16879.1|GT22	2.20e-201	1	523	1	535

PDB Hits     

CPAG_03561-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BAX7|SMP3_EMENI	8.74e-198	1	523	1	538	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q4WTT7|SMP3_ASPFU	8.44e-196	1	524	1	544	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	6.86e-194	1	524	1	540	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q4I785|SMP3_GIBZE	1.71e-162	1	525	1	515	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	5.86e-72	10	392	13	398	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.250940	0.749038	CS pos: 23-24. Pr: 0.3505

TMHMM  Annotations     

Start	End
178	200
252	274
325	347