CAZyme Information: CPAG_00651-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPAG_00651-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: STT3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702	DS268109|CGC4	78833.49	9.6014

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiRMSCC3488	10016	454284	119	9897

• Gene Location: location=DS268109:2051615-2054225(-)

Full Sequence      

MAATAVNPLLKGTTSSNTRGLLRVIILAFIAAAAISSRLFSVIRFESIIHEFDPWFNFRA
TKYLVKHGFYSFWDWFDDRTWHPLGRVTGGTLYPGLMMSVSPSAGLLAAAFIGIAPGYIS
RSVAGSYDNEAIAIFLLIFTFFLWIKALKNGSIMWGALTALFYGYMVSAWGGYVFITNLI
PLHAFVLICMGRYSSRLYISYTTWYALGTLASMQIPFVGFLPIRNSDHMAALGIFGLLQL
VSFVEFLRSQVPGKQFQTVLTTLVLVIFGVAFLGLVLLTVTGVIAPWSGRFYSLWDTGYA
KVHIPIIASVSEHQPTAWPAFFFDLSMLIWLFPAGVYMCFNKLKDEHVFVIIYAVLASYF
AGVMVRLMLTLTPVVCVASALVVSHILETYLRLGSPDPDAQAKQANEKVSQSSPRSTRKR
VVGVYSSVSKALVAGSFVVYLLLFVAHCTWVTSMAYSSPSVVLASKLPDGSQYIIDDYRE
AYYWLRQNTPKNAKIMSWWDYGYQIGGMADRPTLVDNNTWNNTHIATVGKALSSREEVSY
PILRQHDVDYVLVVYGGLIGYSGDDINKFLWMVRIAEGLWPEEVKERDFFTDRGEYRVDD
QATPTMRNSLMYKLCYYNVNALFPGGQGQDRVRGARLPSQGPQLTTLEEAFTSENWIIRI
YKVKDLDNVGRDHNSAVAFEKGHKKKKAASLKRRGRRVLRTE

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	102	620	1.1e-151	0.6810966810966811

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	8.35e-128	36	457	16	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	2.59e-100	36	671	33	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
226369	UhpB	0.008	134	330	4	184	Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA20009.1|GT66	0.0	1	702	1	741
UDD65301.1|GT66	0.0	1	702	1	742
QMW36082.1|GT66	0.0	1	702	1	742
QRD92953.1|GT66	0.0	1	702	1	742
QMW48142.1|GT66	0.0	1	702	1	742

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	6.75e-299	21	671	15	690	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	3.89e-265	33	668	83	777	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	1.19e-246	21	670	17	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	2.38e-246	21	670	17	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	6.54e-244	21	665	17	696	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	5.70e-303	22	686	24	738	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	3.47e-298	21	671	15	690	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|Q8TCJ2|STT3B_HUMAN	2.00e-264	33	668	83	777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
sp|E2RG47|STT3B_CANLF	2.00e-264	33	668	83	777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q3TDQ1|STT3B_MOUSE	2.56e-264	33	668	80	774	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000001

TMHMM  Annotations     

Start	End
20	42
97	119
131	148
168	190
197	219
229	251
263	285
318	340
347	369
422	444