CAZyme Information: CPAG_00109-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPAG_00109-t26_1-p1
• CAZy Family: AA11
• CAZyme Description: mannosyl phosphorylinositol ceramide synthase SUR1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		42369.71	9.4276

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiRMSCC3488	10016	454284	119	9897

• Gene Location: location=DS268109:476945-478384(-)

Full Sequence      

MRKGALIFIIANFIVIAFLVNSVSTLLSLLFEDAATDAISRTELPAPNSTFIDQKKPIIP
KIIHQTYKNESIPAIWQEAQQSCLELHPDYEYKLWTDEKADAFIESQYPWFLETFRNYRY
PIQRADAIRYFVLTYYGGIYIDLDDGCNRRLDPLLVYPAWVRKTSPTGISNDIMGSVPQH
PFFRRVIDSLQTYNRHWVLPYITVMYSTGPLFLSVIWKEYMAGRPSAYERVRVMMADEYN
RHSWSFFTHHPGSSWHGKDARLIFWMGGHWVLLTVLGFVLAGIVGAFLWWGYRRLIVLGS
KYFHRYSPIQTRPSGAILNPSRSFSPSRKLGILPAFLQRRSSSRKRDEENALSDTVYELL
DRPE

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	155	5.2e-24	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.28e-78	40	287	62	312	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.23e-24	73	155	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA57874.1|GT32	6.40e-179	1	362	1	353
AAP47108.1|GT32	6.40e-179	1	362	1	353
QSS66595.1|GT32	1.07e-178	1	360	1	368
BCS17906.1|GT32	5.42e-178	1	364	1	356
CAK42232.1|GT32	1.22e-177	1	362	1	357

PDB Hits     

CPAG_00109-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.83e-102	1	279	1	283	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.15e-99	1	279	1	275	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.49e-85	56	306	79	327	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	4.23e-82	48	288	46	287	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.80e-54	59	266	64	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.461161	0.538837	CS pos: 26-27. Pr: 0.2650

TMHMM  Annotations     

Start	End
5	27
270	292