CAZyme Information: CNN02110-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNN02110-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: putative chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604	AE017356.1|CGC1	66611.43	7.2961

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017356.1:657275-659546(+)

Full Sequence      

MPNISRKPPPSFYPPSHSPSPSLYAPIQSTPAPSYDHHVNNNTLNPFSDAREVGAYAQLQ
GEEPINSAPLYQPPYAPQLLVAQPTPVSARLPFFEAALARARGIQTPNLPEAPTPTYAQP
LPSYLPPPDPNHPDLSVGLTQANTIRYAIDPRSHLREESRSPSPFMDDSFVYNDATHLHN
VEPDVENALLGSGMGYEPEKRVESSMGFNDYDGDLSVPQSFGGRPPSWEQGGILDEKAEM
STTKHFGPAPAGRVGRRAHNAAGYRRIKQSATLDENGFFAIEMNIPTRLAQFLPIKGVEE
QKTTRYTAITTDPDDVPAAGFRLRQNITSPPRQTELFIVITMYNENAELFCRTLYGVMKN
IAHLCGRKNSRVWGKDGWQKVVVCIVADGRKAVNPRVLDCLAALGVYQEGAMTNTVKDRP
VTAHVFEYTTSFALDGDLHFKYPDKGIVPCQIIFCMKEKNAKKINSHRWFFNAFAPLLSP
NVCILLDVGTQPAPKSIYHLWKAFDVNSNVGGACGEIATFKGKTWRSLLNPLVAAQAFEY
KMSNILDKPLESLFGYCTVLPGAFSAYRWIALQNNGDGRTGPLASYFAGEQLNTGKADTF
TGNM

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	342	504	6.4e-77	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	3.25e-116	342	504	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	2.96e-58	338	604	1	190	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	6.15e-18	276	341	6	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
133045	CESA_like	5.81e-16	472	584	71	178	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	5.53e-15	453	580	115	234	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW47172.2|GT2	0.0	1	604	1	604
ADV25813.1|GT2	0.0	1	604	1	606
UOH85558.1|GT2	0.0	1	604	1	604
AFR98718.2|GT2	0.0	1	604	1	604
AUB28903.1|GT2	0.0	1	604	1	604

PDB Hits     

CNN02110-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J9VWT0|CHS6_CRYNH	0.0	1	604	1	604	Chitin synthase 6 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS6 PE=2 SV=2
sp|Q92444|CHS2_PARBR	3.17e-144	236	604	212	576	Chitin synthase 2 OS=Paracoccidioides brasiliensis OX=121759 GN=CHS2 PE=3 SV=2
sp|Q99127|CHS4_USTMA	8.50e-144	246	604	204	554	Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS4 PE=3 SV=2
sp|P30584|CHSA_EMENI	1.01e-141	235	604	195	559	Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsA PE=3 SV=2
sp|P30589|CHS2_NEUCR	2.76e-139	154	604	203	659	Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-2 PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CNN02110-t26_1-p1.