CAZyme Information: CNJ02900-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNJ02900-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	AE017350.1|CGC2	41845.55	4.5758

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017350.1:890640-892134(-)

Full Sequence      

MFANSLPLITALLPLLTLTTQAAAAHSNQPPHLRHRRVLHHRRDIENKHPHVAMAQLPPR
SNAGHADAKKLIKKSVKKRGQTCRTRGSSYSTSASYGDAAAVQTLSSSSDGEPASSSAAW
SDDSSSSSYVAAATPVAATLSNEQAWAPQVTSSSDDWSESTTADSWSSSATSSSAWTQPT
TSSGSDSSSGSSSSGLLTITDATCGYSNSDSDSPNGSEDWLNCGLDGAGWTPPTVTVDEL
IAAELTTDGVFSPCADYVDLFNQYAEQYGLKGIMLASFAMQESTCNPSATGGNGEAGLMQ
LASENCSGAPNGDCYDVDFNIQRAAELFSGLISSNGGNVLLAIGSYNGWYSGLTYAAGTA
AASLGQCSAQNNLDYIHQFCNGWMQNKSGYTLGTYFNLASC

Enzyme Prediction     

No EC number prediction in CNJ02900-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396169	SLT	2.96e-11	261	348	1	94	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
381604	Slt70-like	5.50e-10	257	348	6	106	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
223812	MltE	1.07e-07	256	362	138	253	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
381617	LT_Slt70-like	4.20e-07	257	348	4	104	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
381594	LT-like	4.25e-07	274	348	3	80	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW46053.1|GH23	6.29e-244	1	401	1	401
ADV24528.1|GH23	9.33e-218	1	401	1	400
KNX49777.2|GH23	6.40e-214	1	401	1	402
AFR97355.1|GH23	3.66e-210	1	401	1	399
AUB27369.1|GH23	3.66e-210	1	401	1	399

PDB Hits     

CNJ02900-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CNJ02900-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.030703	0.969284	CS pos: 24-25. Pr: 0.6102

TMHMM  Annotations     

There is no transmembrane helices in CNJ02900-t26_1-p1.