CAZyme Information: CNJ00530-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNJ00530-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		42545.66	8.5472

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017350.1:142433-143807(+)

Full Sequence      

MALKIPNKPAEILTPFPRPDPSPEGLKILRQICRKAVESDEVYSVTFSDLLCPEGKNHLF
TLKPYFWEVEPGKWEKRDGKRNPYCDKPGGQKQLETAAVTIHNLALGAAYLPEFRDGCAK
RLERVLSVFFIDPETRMVPEVWYAQCNPGNKPLKGDYAFEIALRNIILVDQGMRLAASFL
NKRTVDTLTNWIATQAKWIRDSDQGAAARKYEDNKRIWLEAITASHLSFISPPEGNSYAI
SFFQTYAPSHPPKKFFEHELQRTRPRHYTLFALEPLFILAELTLPSSRRLDRYIAQYLRS
LLEFAKQVAPGEIERPLEEQGRYEGRWQWYERMLADWTGQGQRGGEEPDGRAWEGGFTQR
MRMIWGFI

Enzyme Prediction     

No EC number prediction in CNJ00530-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	56	301	1.2e-32	0.8924731182795699

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	1.70e-15	53	311	11	267	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDT67881.1|PL38	6.28e-23	26	273	44	298
UNE47223.1|PL38	1.62e-15	23	327	83	399
ABD80546.1|PL38	4.08e-15	25	282	79	340
EGB14654.1|PL38	8.46e-15	61	280	98	322
CDS07499.1|PL38	9.51e-15	29	284	36	299

PDB Hits     

CNJ00530-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CNJ00530-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CNJ00530-t26_1-p1.