CAZyme Information: CNG04480-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNG04480-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: trehalose synthase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
734		81623.77	5.4910

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017347.1:1278688-1281733(+)

Full Sequence      

MPPGEQPKRRLSTTSSRQPTTIQDIFIGVGLQLAPQPDISEGQEDPGRDLEYSAVIHDGT
GIIDSETFHTTFHTYGKDEDGLAAEMKRVARDMLYLLRAIQTNRQVNVKMIAVAEPVPDE
LRAKNGVEFFPTLWLHMDAIPFITTPSTSIFTKLPAPSTIASGTAAVSAAVKHLHPATHS
ATTADVAPKDHHVQVDCDGQIRLCSILQYQQSSSEALWARFTALSRLLNANKVSIAFFSA
TPQGGGVALMRHALIRLWRMVGLPVKWFVPEGHPTVFNITKTKFHNVLQGVSPKDVEIGE
TDKTWFELWTEQNYESFWSNGALDASIIVIDDPQLTALIPIIKKKRPDAKIIFRSHIQIQ
SDLTDDPSTVQYRTWNYLFNFIKDVDLFLAHPVKFFVPKNVHENLPVLYMAPSTDPLDGL
NKMYGRASVRYYRQYFNQLSQAQCGVKIDWDRGYVCQIARFDPSKGIDVLLKAYLEFRQK
LEESENPPLDNGPQLIIMGHGSIDDPDGSWVYEKIHDTLNSPGYELIHGDVAVVRAPPSD
ALLGCILQGAWVATQLSTREGFEVKVTEAINKRVPIIASDAGGIPLQVKEGKNGWIVPAG
DAAAVSEILYKIHKGELSVHRGLSVEKELDGKSDPNSVAQEWVGNFDEAYRKVHDDDGAT
SEDFWTVGNATRWMLLFAKLLDLKIDQTGEVSEQDVNVLKELEKEKLPSKGEAGGNVWHM
LMGDDMLQGEGALI

Enzyme Prediction     

EC	2.4.1.231:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	454	614	1.5e-24	0.86875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340823	GT4_trehalose_phosphorylase	0.0	234	649	1	378	trehalose phosphorylase and similar proteins. Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT4 family of glycosyltransferases.
223515	RfaB	1.94e-18	231	614	1	341	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
395425	Glycos_transf_1	3.40e-17	451	621	1	150	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
340816	Glycosyltransferase_GTB-type	4.76e-12	382	597	52	235	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
404563	Glyco_trans_1_4	5.54e-12	458	609	7	136	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW44824.1|GT4	0.0	1	734	1	734
AUB26242.1|GT4	0.0	1	734	1	734
AFR96337.1|GT4	0.0	1	734	1	734
UOH82745.1|GT4	0.0	1	734	1	734
ADV23288.1|GT4	0.0	1	734	1	734

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X6Q_A	3.29e-38	234	629	42	394	Crystal structure of trehalose synthase TreT from P.horikoshi [Pyrococcus horikoshii],2X6Q_B Crystal structure of trehalose synthase TreT from P.horikoshi [Pyrococcus horikoshii],2X6R_A Crystal structure of trehalose synthase TreT from P.horikoshi produced by soaking in trehalose [Pyrococcus horikoshii],2X6R_B Crystal structure of trehalose synthase TreT from P.horikoshi produced by soaking in trehalose [Pyrococcus horikoshii]
2XA2_A	2.07e-37	234	629	42	394	Crystal structure of trehalose synthase TreT mutant E326A from P. horikoshii in complex with UDPG [Pyrococcus horikoshii],2XA2_B Crystal structure of trehalose synthase TreT mutant E326A from P. horikoshii in complex with UDPG [Pyrococcus horikoshii],2XA9_A Crystal structure of trehalose synthase TreT mutant E326A from P. horikoshii in complex with UDPG [Pyrococcus horikoshii],2XA9_B Crystal structure of trehalose synthase TreT mutant E326A from P. horikoshii in complex with UDPG [Pyrococcus horikoshii],2XMP_A Crystal structure of trehalose synthase TreT mutant E326A from P. horishiki in complex with UDP [Pyrococcus horikoshii],2XMP_B Crystal structure of trehalose synthase TreT mutant E326A from P. horishiki in complex with UDP [Pyrococcus horikoshii]
2XA1_A	2.82e-37	234	629	42	394	Crystal structure of trehalose synthase TreT from P.horikoshii (Seleno derivative) [Pyrococcus horikoshii],2XA1_B Crystal structure of trehalose synthase TreT from P.horikoshii (Seleno derivative) [Pyrococcus horikoshii]
6ZJ4_AAA	1.51e-30	233	604	27	351	Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis],6ZJ7_AAA Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis 768-20],6ZJH_AAA Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis 768-20],6ZMZ_AAA Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis],6ZN1_AAA Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6YRN9|TREPH_PLEPU	5.28e-101	193	676	236	694	Trehalose phosphorylase OS=Pleurotus pulmonarius OX=28995 GN=TP PE=2 SV=1
sp|O75003|TREPH_GRIFR	1.45e-96	147	676	188	686	Trehalose phosphorylase OS=Grifola frondosa OX=5627 PE=1 SV=1
sp|Q9UV63|TREPH_PLESA	3.14e-96	193	676	236	706	Trehalose phosphorylase OS=Pleurotus sajor-caju OX=50053 GN=TP PE=1 SV=1
sp|Q7LYW5|TRET_THELN	6.22e-38	229	629	35	392	Trehalose synthase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) OX=523849 GN=treT PE=1 SV=1
sp|Q9HH00|TRET_PYRFU	6.22e-38	229	629	35	392	Trehalose synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=treT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000085	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CNG04480-t26_1-p1.