CAZyme Information: CNG03330-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNG03330-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: mannosyl-oligosaccharide 1,2-alpha-mannosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864		96802.09	6.0495

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017347.1:939048-941922(+)

Full Sequence      

MGRSLSPKPTGRNMPYAPAYPSSYSDPEKGLPSSPSSLARHMLVPRKPRWILGGLLICVV
ILYYMTSNKDETAWGHGGSWDAEGDDSRAGSKPSDDKSESPTYSDYIVDAHGNHFVKGWQ
QPITPMHPDVDLLPRAPSIFPYLNVSESELPEEKIYPDSDLRLIISQPPDLPEEHSNSMP
EDAWSQKWSGPTVWDQPKGEMKRVQWEGFAGGRDRWESENDRKVREERKEAVKRGFKHAW
EAYKRHAWGHDEVRPVSLTHSDPFNGWGATIVDSLDTLLLMGFSNEYNLCRPHVNQLNFH
WVNGRDWNDGYVSEELSGSGEVYALNRDKTVGLAVFETGIRYLGGLLGAYDLSGDDLLLE
RAVDLADILSTAFKTGSGLPAGRMDPGTKDEMIRLGTVSLAEVGSMSLELIRLSQITKDR
KWFDLAQRAMDYIHERVIPRGTHSPLIPMWFQPDAPLTTSMHGGLTFGGLADSYYEYLIK
TYKLLGTSEVSQVWRDVYERSIDKAKETLYVDIDIVPGRNILAVGKLENGRLIPELEHLT
CFIGAMLGLGAKLLDRPGDMRDAERVTASCYWLSADTPTGLQPEVVEWYAPHETSAMYEN
VSISGGGRHHPLIFSEDESKDRDGMYRDRNGVLRWTEDNEPVLYTDREKKKNGQTPIKYA
QRLKGTPTGARKVSTRGLNRPETIESIFYMYRITGDRKWQEKGWKMFTSWMNASTVDGGF
SSVEDVTKLPVRFGDNMESFALAETFKYHFLLQSEPDVLSLDDYVLNTEAHPFLTNPKLD
PKAHTTHTRFWSPPPSQDLGVRGQGTNAQKFARLEVIERASLPFLPAPPQNAPGGGGGRG
MGGGGGKPGVIPKLPPEILKKLNQ

Enzyme Prediction     

No EC number prediction in CNG03330-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	236	773	1.4e-143	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	7.28e-177	236	773	2	451	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.75e-121	173	778	24	521	glycoside hydrolase family 47 protein; Provisional
271199	LanC_SerThrkinase	0.005	345	446	94	188	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAY09771.1|GH47	0.0	1	864	1	864
CAY06011.1|GH47	0.0	1	864	1	864
AAW44752.1|GH47	0.0	1	864	1	864
AFR96466.2|GH47	0.0	1	860	1	861
AUB26389.1|GH47	0.0	1	860	1	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	1.46e-71	236	772	13	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.72e-71	236	772	18	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.81e-71	236	772	18	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KK7_A	8.09e-71	236	772	13	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	1.28e-70	236	772	96	531	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UKM7|MA1B1_HUMAN	1.97e-68	236	772	257	692	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|B2GUY0|MA1B1_RAT	2.38e-64	227	772	206	650	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|A2AJ15|MA1B1_MOUSE	8.61e-64	227	772	207	651	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|Q8J0Q0|MNS1_CANAX	8.46e-63	232	773	42	506	Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans OX=5476 GN=MNS1 PE=3 SV=2
sp|Q8H116|MNS2_ARATH	3.51e-62	227	772	97	534	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999996	0.000029

TMHMM  Annotations     

Start	End
50	67