CAZyme Information: CNG00070-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNG00070-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429		49334.71	6.1160

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017347.1:15482-17144(+)

Full Sequence      

MIVRITHAYVTVIVCVTTLIFIAHIHPGTSFYLPLLPSSYTTNYYTYTFPDPVEAENRHL
TEEQCQERYPDLYLEADRAQQWFISKGGISKKMVDEAEEEGNARLVILNNQLFVKAYKGG
INTRTQAAIAAVYGALLTATEPLPDVDFVIQTSDAGGGNHPHFALCRKADQKDLWLMPDF
GFFSWPEPGVGSYSEVRTKTLDYELDMGLEVDDKLDVTKSDWFNKTQQLFWRGSPMVEVR
NDLLRASQDQPWSDVQPLDWGKVSQDEAERIKNNGDLKSPAEHCKYAFLAHVEGWAYSGR
LKYLQQCRSVIVAHPLKYIQHYHHLLNGRDGDPNQNYVEVPLPLEKNLPRAMEDLLKEEN
EEKVQRIADNNWKSMRQGWISPAANECYYRHALRQYASVQTFKPSLEGRAVPYESFLLMG
KTHWDPHRK

Enzyme Prediction     

No EC number prediction in CNG00070-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	144	401	2.6e-21	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	4.88e-32	88	411	24	334	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	3.42e-18	142	403	1	256	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76195.2|GT0	1.06e-311	1	429	1	429
QSZ37094.1|GT0	1.29e-68	60	427	79	435
BCR90563.1|GT0	1.57e-62	54	419	110	466
UDD61446.1|GT0	1.69e-61	54	418	71	436
USW51979.1|GT90	2.13e-61	34	424	57	454

PDB Hits     

CNG00070-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q566E5|PLGT3_RAT	1.08e-10	143	406	232	479	Protein O-glucosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Poglut3 PE=2 SV=1
sp|G5E897|PLGT3_MOUSE	1.89e-10	143	406	227	474	Protein O-glucosyltransferase 3 OS=Mus musculus OX=10090 GN=Poglut3 PE=1 SV=1
sp|Q7Z4H8|PLGT3_HUMAN	2.52e-10	218	406	300	478	Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998346	0.001673

TMHMM  Annotations     

Start	End
5	27