CAZyme Information: CNF01430-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNF01430-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: alpha-1,6-mannosyltransferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500	AE017346.1|CGC4	56887.18	6.7468

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017346.1:416593-418310(-)

Full Sequence      

MSVLKWLNPRSNKYSSLPTSNPSSGHLNPELFHSSPAKRKRLLQIGLGTVFSILLLGAVI
RQSVLPRSLVTGQKDNDWQDGVPGIIGDVSANPNQENPIEASGEIELEREKPGWTEAMGW
KSSSNKGLADLGEIAEQRYILNVDAGESGTREYFRRLYDFAVTLPVRLHSPFLSSLHDHL
PPAYIDALPNYPNSQPYLPSMVSYKNIHMTDKTFNPQNKFIQSWEETNSKDGWQINFLDD
QQAQDWVEKNFRRSDVEWAWNFMHRGVLKADFLRYLLPLVHGGVYSDVDTRPIRPIEQWG
LLDTEYLDLTATDGPSWKTALSTHPAVIVAVDVDVHAKQGWERYWPRPLGICQWTLSSAP
NHPIFLDAVRRVVNSSRVVQAWEEQRDEEVTRLEREQPRGWSREVDRLRKLGRSEAMSVM
EWTGPGLFTDSVLAFLLSRYNVTWHRLRGLEHPLRIGDVLILPITAFSPGGEKDFRAKGP
DSPQANVLHNFRGSWKPDGA

Enzyme Prediction     

No EC number prediction in CNF01430-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	219	299	2e-17	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.34e-11	166	470	33	322	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.78e-09	217	300	4	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW43978.2|GT32	0.0	1	500	1	500
AUB26041.1|GT32	0.0	1	500	1	500
AFR96155.2|GT32	0.0	1	500	1	500
ADV23039.1|GT32	0.0	1	500	1	500
UOH81886.1|GT32	0.0	1	500	1	500

PDB Hits     

CNF01430-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.76e-39	233	498	165	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	7.14e-36	191	499	93	379	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	9.88e-24	211	498	110	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	9.43e-19	267	468	196	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000005	0.000017

TMHMM  Annotations     

Start	End
42	64