CAZyme Information: CNE02900-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNE02900-t26_1-p1
• CAZy Family: PL35
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		40950.92	5.1396

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017345.1:770957-772247(-)

Full Sequence      

MTTPKIQREYLFKDDPRQPEVHCSTIQAACGVEYVTWFGGTKEGTSDVKIWFSKCTNGCW
TPPRVIAGSGDIVHWNPVSFLPDPKGAPGHLYVFYKTGTPIPTWKTYVIETIDGGNTWTE
PRELVPGDHSGGRGPQKNPPIVLSNGDWLSGASKEVTLEGGKGLWDAFADIAPTPKEGDT
FKQGERWVKAEFIKLPADRGVEGGSFPGEGIIQPSLWESADKPGHVHMMCRSSIGRIVRA
DSEDYGRTWTPGYATDLPNNNSGQCVTRLRDGRLVAAVNDVYKNWGPRTPLVLKVSFDDG
ETWSPWCTLEDQAPPASFQRVIALETGIVNDGKSEFSYPTVTPTAETDEIGVWVSYTWQR
RGIAVCKVTDGE

Enzyme Prediction     

No EC number prediction in CNE02900-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404074	BNR_2	8.45e-59	34	348	4	277	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
227036	COG4692	8.45e-34	16	367	29	370	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
271234	Sialidase_non-viral	1.94e-27	35	311	28	301	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW43695.1|GH33	6.02e-298	1	372	1	372
AUB25393.1|GH33	9.12e-284	1	372	1	372
AFR95572.2|GH33	9.12e-284	1	372	1	372
UOH82501.1|GH33	1.07e-267	1	358	1	358
ADV23792.1|GH33	5.67e-170	6	372	24	394

PDB Hits     

CNE02900-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CNE02900-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000005

TMHMM  Annotations     

There is no transmembrane helices in CNE02900-t26_1-p1.