CAZyme Information: CND03380-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CND03380-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: alpha-1,6-mannosyltransferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439	AE017344.1|CGC6	48731.50	5.4487

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017344.1:916412-918021(-)

Full Sequence      

MPLATRPHPRLLSPILALLFIIFALSSLFSLFANSTSILNFVPTALVKGERTPGCRGNAA
ISIQNLLDAGARHVAESNRLFDATGAKRDLGIDLGENWTLQSYASYLENIWQEFLQEPQG
SNADHPTLQTVLSYTSLLPREQGSETAIPKFIYTTDLLEPQQLPEQFQSWITQNPEWTTM
FVNDAEIDTWLEDRLGAGEVKTKAQEELLALKESYGVVRADLFRYLVLLLNGGVYTDTDT
ASVLPIAQWARSPTVAPVAPLLTAIPQLISIIQDPSSQTLPSTPSTSKPSLVVAIESDAL
STGANWREQSFARSIQIVQWTIMANRGHPVLLDVIGMALKKSEEIRLMKSNNDQVRKEDV
NILNWSGPGAFTDAVFRYLFVRYGFHPAQASGLKEPLQIGDVIIMPVHSFRADASEGFQG
EHRVVWHGFFGRWKGKTDK

Enzyme Prediction     

No EC number prediction in CND03380-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.08e-13	115	359	53	264	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.30e-10	166	249	7	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW42866.2|GT32	0.0	1	439	1	439
AFR94929.2|GT32	1.31e-257	1	438	1	445
AUB24663.1|GT32	1.31e-257	1	438	1	445
KGB74945.2|GT32	1.86e-246	1	439	1	440
ADV21986.1|GT32	1.09e-226	1	439	1	420

PDB Hits     

CND03380-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	2.35e-28	107	434	58	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.51e-23	148	434	142	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	9.22e-21	144	410	126	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	8.60e-16	144	439	92	475	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999679	0.000336

TMHMM  Annotations     

Start	End
11	33