CAZyme Information: CND02810-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CND02810-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: capsular related protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		73339.88	8.3072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017344.1:763278-765565(+)

Full Sequence      

MTPSRAYTPPVSPKLKNTNLSYTILPHGAPPVSRPIRRPKKIIYLAAIFFLLYWFGIRHG
LGRERLPIPPLGYAVKGGRRGRKSSLAWHSKGMATLLQPQPGTKQEHPIYELMERAETHW
TSMLASQSTTLPQAVAQYRKRYGIAPPLGFDAWFDFCKRHDIKIIDEYDQMMKDILPHHA
LPPVMFIARSKALEGAAYTYTLDISQEHVNITGERSSYDRPQHLLKLIAGFKGDLPPEFR
LRVTGSDHNTGSVVLGMDQRMRAMELVQQSKHFDEDELKSLEDPYRTPAWGWFKACPLDS
PANIRPWSENATDEFQPKSFIHDHLPIMDFCEYPELKRLHGAMSLDYANRSPSVLKPILV
LSKFPFDSSFQTPPMEGYMNITEEDVLFLDRWEDKTDNRLFWRGSTTGGYTAQRDWKDSH
RLRLHLMINGPKGGNAWWDQQLRDVMVPDGEGGFKIVRRWERVLSKAYADVKLSGQPVQC
PSEEICREVADTIEFGKKVWPDEAAVYKYNLDVDGDGWSSRFHRLLISGSPVIKFTMFPE
WHQEWLTPWYHYIPLKPDYSDLYDIMAFFVGPLDDAGHVDFSKGHDYLAKKIGNAGQKFA
LEHSSWVDMQAYMFRLLLELQRLHSLNRSSMSYKAQ

Enzyme Prediction     

No EC number prediction in CND02810-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	391	624	7.9e-62	0.74

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.04e-18	497	623	136	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.25e-13	507	623	216	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW42911.1|GT90	0.0	1	636	1	636
AAR84596.1|GT90	0.0	1	636	1	636
KGB74886.1|GT90	0.0	1	634	1	634
UOH80885.1|GT90	0.0	1	634	1	634
AUB24727.1|GT90	0.0	1	634	1	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.02e-07	507	627	237	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.96e-06	475	623	246	378	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.95e-75	107	630	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	5.01e-09	507	623	362	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	1.52e-08	507	627	265	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q9JHP7|PLGT2_MOUSE	2.67e-08	507	616	362	459	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1
sp|Q7ZVE6|PLGT2_DANRE	3.51e-08	507	623	361	465	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999984	0.000022

TMHMM  Annotations     

Start	End
42	61