CAZyme Information: CND00790-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CND00790-t26_1-p1
• CAZy Family: GH128
• CAZyme Description: glucan 1,3-beta-glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		51883.46	4.5859

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017344.1:210641-212715(-)

Full Sequence      

MVKLSPCPIILLSHFLIPAIASPVRPLAPLGNDGSVILNKRTTLAPGFTWGLDPMRGVNI
GGWLVLEPWITPSIFEGKPDWVVDEWTYGVYMNNQSDTMDEITNHWNTWFSYTELHNIAA
VGLNTIRIQIGFWSVIPLENGEPYLVGAYDYLKLAVTWASSLNLKVMVDVHGCPGGQNGF
DNSGIRGVREWFTNDTNISRTLSTLQVLTAEFSQSFYNNTVIAIELVNEPFPYSTSELNI
LKSYYQAGYRTVRSNDGASKVVVAIDEGFQGLQTWEAFMQESSYNNVAMDTHIYTILDWY
CGQQDYLVASNNVHWTIVGEFVPANTDCAYWLNGRGVGSRYDNTLNTSAALQYPGNCDGK
TGADPSKFSAEYVEYLAKSFETQTWVYEQASGWVMWTWKTEQAADWSMQTGMTYGWIPTP
IYSKPHGTPCASNTSAKATSGETRYRVDWWLVLVPWVVLLLH

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	104	401	2.7e-90	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.98e-34	56	426	19	390	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.97e-08	115	257	30	159	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW43031.2|GH5_9	0.0	1	462	1	462
AFR95190.1|GH5_9	1.30e-268	39	427	3	411
AUB24953.1|GH5_9	1.30e-268	39	427	3	411
ADV24619.1|GH5_9	6.71e-261	1	427	1	417
UOH81096.1|GH5_9	1.02e-254	39	415	3	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H4P_A	1.05e-65	53	432	11	405	Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
2PF0_A	4.08e-62	50	430	8	397	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	6.87e-62	50	430	2	391	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3O6A_A	7.82e-62	50	430	7	396	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PB1_A	8.03e-62	50	430	8	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	2.76e-75	48	433	30	419	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|A2RAR6|EXGA_ASPNC	1.16e-74	40	396	27	381	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	3.09e-71	53	430	27	403	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|O93983|EXG2_WICAO	7.90e-71	11	430	2	426	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q0CR35|EXGA_ASPTN	1.16e-70	27	396	15	380	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.073776	0.926202	CS pos: 21-22. Pr: 0.8878

TMHMM  Annotations     

There is no transmembrane helices in CND00790-t26_1-p1.