CAZyme Information: CNC04850-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNC04850-t26_1-p1
• CAZy Family: GH109
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	AE017343.1|CGC5	46878.22	9.1985

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017343.1:1468641-1470069(+)

Full Sequence      

MAKLSPLTLIFIAACLSRILQLTILSGLSKALPLFDTSPSLLLSSPPPALRWDAIHFASV
AYNGYEYEQQVAFQPGWLAVMRLAGEGVRFIRAASVVELKDVILGGTIVANVAFVAATLV
LYKLTKHIFNPTFAFLTSLLYLLPPTATPSAPYTEPIYSLLTFSGIYLLSIKRQMVLAGL
CFAGATTIRSTGIFNSITLMCFAVFGDAHIFDLDPKDYCKIRKKLKPFLSAILVVAPFFM
FQHYTETVFCTRELKRASTARPWCSNSPPVSYGFVQKLYWNVGPFEYWTVSQLPNFALAM
PILFFSLAGVVKFFSHLVSSSQVLNHGTEEIPPPPILFELYSVHVLTMALLLFTSHTQIT
LRVCLGDPVVWWNAVKLGFDNVQIGEAPTGQVKVNKFGRYWIGWTVVWGAVAAVLWAGHY
PPA

Enzyme Prediction     

No EC number prediction in CNC04850-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	41	423	5.4e-100	0.8894348894348895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.40e-36	52	423	60	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	2.06e-15	51	423	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW42711.1|GT76	3.81e-311	1	423	1	423
EAL22094.1|GT76	3.00e-308	1	423	1	423
UOH80020.1|GT76	3.01e-273	1	423	1	420
AFR93820.1|GT76	1.74e-272	1	423	1	420
AUB23397.1|GT76	1.74e-272	1	423	1	420

PDB Hits     

CNC04850-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP62|GPI18_CRYNJ	6.77e-312	1	423	1	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|P0CP63|GPI18_CRYNB	5.33e-309	1	423	1	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	3.93e-33	35	423	29	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	1.01e-27	21	423	32	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	3.50e-27	35	423	47	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.508834	0.491170

TMHMM  Annotations     

Start	End
7	29
102	121
128	147
152	171
191	213
228	250
296	318
331	353
397	419