CAZyme Information: CNC02590-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNC02590-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: polygalacturonase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478		53658.12	5.0321

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017343.1:739743-741668(-)

Full Sequence      

MRFLCLFACVLSSAVVQGSLFVLSESQDQKIIPEILEKDNSIWPYHHEVFEFHPEHKDLS
TGLVRPLCVLHTLGEGADDSYNFEKAVHQCGRGGIVRLPDANYTISRPLDIYLSNSVLDL
HGWLSFSANVSSWIENRMPLGFQNQSLAFVVRGNDYILEGNDKGGINGNGQAWYDYAKDY
GNKFGRPMSLAIKNSKNVIIKNFSIVQPQFWASLIWGSENVYIKDFYVNATSFNPESSSD
QKNWLQNTDGSDTYQSHNVTYENMIYQGGDDCVALKPNSTSITLRNVTCYGGTGIAFGSI
AQYAGVKDVIEDVFMEDIRLYPSNQCPAYQGVYFKSWLGYSIGQPPNGGGGGYGYCRNVT
VKDVYMEDIWHPLVVQSDLTYLTLDREKFTDSGLFEWYDIHLKNFTGKALGNRIAWMSCS
KLTPCHDWTFEGMDIMPGKQDHPEIHYTCNNFVLGGNDGLNQCHPSNSKLETENGGTL

Enzyme Prediction     

No EC number prediction in CNC02590-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	141	451	1.1e-61	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	3.19e-21	164	452	61	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	3.96e-19	154	451	156	417	polygalacturonase ADPG
215426	PLN02793	6.33e-15	164	437	151	396	Probable polygalacturonase
178580	PLN03003	4.03e-14	157	435	116	357	Probable polygalacturonase At3g15720
215540	PLN03010	2.96e-13	74	470	56	409	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW42245.1|GH28	0.0	1	478	1	478
AUB28044.1|GH28	0.0	1	478	1	479
AFR97960.2|GH28	0.0	1	478	1	479
ADV21054.1|GH28	0.0	1	478	1	474
KGB77456.1|GH28	0.0	1	478	1	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	7.02e-18	65	377	16	302	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	8.67e-11	150	438	65	334	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NJB0|RGXA_ASPFN	2.66e-109	68	435	31	412	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2UP32|RGXA_ASPOR	2.66e-109	68	435	31	412	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|Q2EQQ2|RGXA_ASPNG	9.83e-104	68	456	32	433	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	1.96e-103	68	456	32	433	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|A2QG68|RGXB_ASPNC	4.68e-61	62	461	28	414	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000271	0.999685	CS pos: 18-19. Pr: 0.9680

TMHMM  Annotations     

There is no transmembrane helices in CNC02590-t26_1-p1.