CAZyme Information: CNBN0640-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNBN0640-t26_1-p1
• CAZy Family: GT76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419	CM000053|CGC2	45499.30	3.9695

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansB-3501A	6608	283643	108	6500

• Gene Location: location=CM000053:213532-215294(-)

Full Sequence      

MPLMTQVPQPAATFQREYTNPSAHLPIPSENYYPISNEPTTSFEDVAAQQKARSRKRWFI
IGGIILAVAAVVGIVVGVVVSQVNKNDDDNSSNSSSNGTSSSGNGTLTVGSDPSTFEKDS
RLHQVFWGFAYTPNDVQLPDCAHYSFCHNLPLGMPGLRLYGANCNQTALVMQAIQDTKVN
MTIWPAIYIDSNETAYENQLEAVVDALQTYGVDMVEGITVGNEYILNTAGSDSTTSSAYK
SALATIADKITEVNSTIQALGLSKQLPIGTSDAGAVMSKSLGESVDFFMANVHPWFGSLA
IDDAATWTYEFFQEFDVEVAAEATNNPTMYIAETGWPTNSSSSSESNDGAGSPQGDASVA
NLQTFLDTFVCQANANGTQYFYFEAFDEPWKEIYGGVEPWWGLFDFDRELKNITIPTCN

Enzyme Prediction     

No EC number prediction in CNBN0640-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	155	411	8.4e-32	0.8938906752411575

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.84e-30	157	408	79	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	6.54e-09	218	411	89	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW47222.2|GH17	5.62e-277	1	419	72	495
UOH85421.1|GH17	3.62e-257	1	419	54	477
AUB28743.1|GH17	1.20e-255	1	419	73	496
AFR98574.2|GH17	1.20e-255	1	419	73	496
KGB79281.2|GH17	5.88e-240	1	419	72	497

PDB Hits     

CNBN0640-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WUK5|BTGC_ASPFU	1.94e-51	119	418	377	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	1.94e-51	119	418	377	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|A2QN74|BTGC_ASPNC	2.33e-49	100	418	353	678	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2
sp|A1DEV5|BTGC_NEOFI	4.67e-49	119	418	377	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|A1CAI0|BTGC_ASPCL	4.69e-48	54	418	314	689	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999227	0.000759

TMHMM  Annotations     

Start	End
58	80