CAZyme Information: CNBL0350-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNBL0350-t26_1-p1
• CAZy Family: GT39
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863	CM000051|CGC1	95304.98	5.7836

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansB-3501A	6608	283643	108	6500

• Gene Location: location=CM000051:102959-105818(+)

Full Sequence      

MPTNNTNLDRSFLTANIDDLLKQLTTEEKISLLAGKDWWNTVPIPRLNIPSIKMTDGPGG
ARGDSFYHMTPACALPSATSLASTFSPDLIHSAGNLLALETLARNAVCLLAPTINIQRSP
LGGRAFESFSEDPTLSGLIAAAYVAGLQEGGVSAAIKHFVGNDQEHERMGEDSVIAPRAL
REIYLRPFQIALKKSKPQAFMTAYNKLNGTHCSENEWLLEELLRKEWGFDGLVMSDWYGT
YSISESINAGLNLEMPGATRWRPNGLVTHLIKAHKIDPRQLDKVAGGVLRWVQKLAKKNE
ELVYSPPGKEKTRTEDQAEDAKLLRRLAGESIVLLKNELNVLPIREPKKIAVIGPNAKAK
VLTGGGSAQLRSAWSSTPWQGLSDNAPEGVELSYSLGCHSDKFLPILDDSFTCPDGSPGF
QLSHFPITSSGDKAEEPVHVETWDSSDMFLADFTAPGLTKEYFTQLDAVWTPVEDGEYEF
GVVVTGKGWFWINGELVIDASREDERSTSFFNLGTKEIKGRTRAKKNKRYDIRFLHDTRP
YSVNNINTPIASAGMRLGYIQVIPASTLLSNAVSLAASSDVALLVIGLNSGWESEGYDRP
DLSLPMDTDKLVNAVAEANPNTIVVIQAGSAVSMPWLDKVKGVVFAWYLGNETGNAIADI
IYGYTNPSGRLPMTFPKRELDIPANLNYKSARTRVYYDEGIWVGYKHFNARGIDPLFPFG
HGLSYTTFAYSGLHISQVPESPKNVGADGWRVEVGVQVENIGMEEGAHTVMFWLSPPPES
PNGLKHPKWTLQGFQKVYGLKPGAKREIKVTFDKYAVSHWDELWNTWRAELGEWTVRVGV
DAQNISGEKATFKIEDDLEWRGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	44	256	1.6e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.11e-62	15	852	36	762	beta-glucosidase BglX.
224389	BglX	8.96e-58	44	369	55	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.52e-52	332	725	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	3.50e-34	20	798	56	729	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.85e-32	42	290	59	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW44922.2|GH3	0.0	1	863	1	863
UOH84802.1|GH3	0.0	1	863	1	863
AGV14847.1|GH3	0.0	1	863	1	863
AUB28992.1|GH3	0.0	1	863	1	863
AFR98796.2|GH3	0.0	1	863	1	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.38e-210	16	863	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	8.74e-206	16	863	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	5.82e-129	13	845	1	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.76e-113	13	846	1	656	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.75e-103	17	861	4	720	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	2.61e-234	16	863	5	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	2.09e-233	16	863	5	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	1.14e-232	16	863	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.14e-232	16	863	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.29e-231	16	863	5	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CNBL0350-t26_1-p1.