CAZyme Information: CNBL0340-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNBL0340-t26_1-p1
• CAZy Family: GT35
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		61098.97	6.4631

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansB-3501A	6608	283643	108	6500

• Gene Location: location=CM000051:97939-99887(-)

Full Sequence      

MASKSSSIHPYSPLAYPRRRTSLSVALNSHPLQPPYPYSYPSHRRRAGTMPSQRTRRSRD
TSTSLTRKTVIAFLVILSLVLLGTVIVLSTVSYYLAIPSWAYLTETEVAWRAEDVIKPLL
EQPRPKLSKRVQWGELDSDVLSYSSTGAAASASTISVDSATMTAETWDEFKEEMEELDAA
EEVDEDIATQPEGEAVDTDPTATSSIEEDNGQWGIDGMGTGSYWMRNDWDGRVRDTDSWE
RLYNVTNRPGENIPRLIHQTWKDDQLPEKWRKAWKECREGMPDYEYMLWTDDLSREFIAK
HYPAHLHMYDSYEFPIQRADSIRYFILHHFGGVYMDLDIGCRRRLDPLLQGDWEVILPIT
KPVGISNDLIFSSKGSAFMDGTVHGLAAFNHKYFSNYPTVMFSTGPMFLSAQYAIFSASH
PLTESHPRSEIRVLPKSLYGKNAPISDVPHSFFSHFYGSSWHADDAGFITFLGHWGKRLM
WIGVVILICGAIRLIWVKRKAAAGHQYQLLSILPTTRSPSPSGYDTVEASKTCAGSIHVS

Enzyme Prediction     

No EC number prediction in CNBL0340-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	269	350	1.5e-20	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.06e-43	253	475	82	295	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.49e-23	267	349	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW44921.1|GT32	0.0	1	540	1	540
AUB28991.1|GT32	0.0	1	540	1	535
AFR98795.2|GT32	0.0	1	540	1	535
ADV23773.1|GT32	1.42e-315	1	526	1	526
UOH84801.1|GT32	4.18e-313	50	540	1	486

PDB Hits     

CNBL0340-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	2.38e-51	246	514	55	319	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	2.40e-49	242	475	44	269	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.20e-38	240	489	71	305	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	9.58e-38	230	466	32	256	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.10e-36	249	472	58	270	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000000

TMHMM  Annotations     

Start	End
71	93
479	497