CAZyme Information: CNBK1720-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNBK1720-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571	CM000050|CGC4	61879.54	4.8476

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansB-3501A	6608	283643	108	6500

• Gene Location: location=CM000050:502079-503909(-)

Full Sequence      

MHIAYILGLVPLAFAGVIKHDPPKFQPIQSTRIVRLHPNGDKSKCVDLLGNTRQDGQPVQ
ICDCDGTPAQDWVLNAGRGQTKVQLAGTSFCLDATHPYAADGTNMKIWKCLDVQQQDWYW
TSDNRIVLRDQGKCLDWATGDRSDFNQLQVWRCSTDNNNQVWTTGPDYGGNHGGDAGGNP
GGNQGDDSRGKTNTGGNPGGNQGGDSGGKTNHIIPDPPGPDPNSEPLNPALEAIVNVTEA
AGPWPPMINFDGDYSNDDVTVSDQVPFDYCIGEGSGNPTDDEGQQQGQNFTANVAGIGRD
FCLDNFGNPDIRNTISFDNNTSIGNGADTGRALHKRTFADSGATGTPNRWRRGSVISICV
ERNNNYLVPYASSPVPIRASAIVASAMVRAINFWNAGLNKRFVSFEFVENCNDAVFHTLA
VDQIKSAKEPTVLATAPFPPRGEEGARNRNIFVWNTAFEANFQNVLTFIMSHELGHTLGL
AHEDCKSRDQPCEVITDKVAGSVVESRISGSTTQLFNGPTPLDIAGANEYYSLAAGPNTP
ENIVLWPATRGPFINYPPLPKCKWFLGICYY

Enzyme Prediction     

No EC number prediction in CNBK1720-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	37	163	4.5e-19	0.648936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	4.39e-17	30	162	2	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	2.80e-15	34	164	1	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
411518	lectin_1	1.51e-13	41	164	719	836	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
238092	RICIN	2.44e-10	88	168	9	86	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	7.73e-10	86	167	8	87	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW46144.1|CBM13	0.0	1	571	1	571
AGV14186.1|CBM13	0.0	1	571	1	577
AUB23598.1|CBM13	0.0	1	571	1	577
AFR93997.1|CBM13	0.0	1	571	1	577
UOH83865.1|CBM13	0.0	1	571	1	540

PDB Hits     

CNBK1720-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CNBK1720-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000267	0.999705	CS pos: 15-16. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in CNBK1720-t26_1-p1.