CAZyme Information: CNBJ2980-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNBJ2980-t26_1-p1
• CAZy Family: GT24
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	CM000049|CGC5	41416.37	7.7006

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansB-3501A	6608	283643	108	6500

• Gene Location: location=CM000049:944391-945765(-)

Full Sequence      

MALKIPNKPAEILTPFPRPDPSPEGLKILRQICRKAVESDEVYSVTFSDLLCPEGKNHLF
TLKPYFWEVEPGKWDCDKPGGQKQLETAAVTIHNLALGAAYLPEFRDGCAKRLERVLSVF
FIDPETRMVPEVWYAQCNPGNKPLKGDYAFEIALRNIILVDQGMRLAASFLNKRTVDTLT
NWIATQAKWIRDSDQGAAARKYEDNKRIWLEAITASHLSFISPPEGNSYAISFFQTYAPS
HPPKKFFEHELQRTRPRHYTLFALEPLFILAELTLPSSRRLDRYIAQYLRSLLEFAKQVA
PGEIERPLEEQGRYEGRWQWYERMLADWTGQGQRGGEEPDGRAWEGGFTQRMRMIWGFI

Enzyme Prediction     

No EC number prediction in CNBJ2980-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	86	292	8.2e-27	0.7383512544802867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	2.47e-13	68	302	41	267	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
277098	PHD_BAZ1B	0.008	31	76	3	43	PHD finger found in bromodomain adjacent to zinc finger domain protein 1B (BAZ1B). BAZ1B, also termed Tyrosine-protein kinase BAZ1B, or Williams syndrome transcription factor (WSTF), or Williams-Beuren syndrome chromosomal region 10 protein, Williams-Beuren syndrome chromosomal region 9 protein, or WALp2, is a multifunctional protein implicated in several nuclear processes, including replication, transcription, and the DNA damage response. BAZ1B/WSTF, together with the imitation switch (ISWI) ATPase, forms a WSTF-ISWI chromatin remodeling complex (WICH), which transiently associates with the human inactive X chromosome (Xi) during late S-phase prior to BRCA1 and gamma-H2AX. Moreover, BAZ1B/WSTF, SNF2h, and nuclear myosin 1 (NM1) forms the chromatin remodeling complex B-WICH that is involved in regulating rDNA transcription. BAZ1B contains a WAC motif, a DDT domain, BAZ 1 and BAZ 2 motifs, a WAKZ (WSTF/Acf1/KIAA0314/ZK783.4) motif, a plant homeodomain (PHD) finger, and a bromodomain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDT67881.1|PL38	7.01e-20	26	264	44	298
UAL11661.1|PL38	2.21e-12	42	273	86	332
ATC32744.1|PL38	7.09e-12	42	273	84	330
UNE47223.1|PL38	7.46e-12	23	318	83	399
AZS22335.1|PL38	9.40e-12	42	273	81	327

PDB Hits     

CNBJ2980-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CNBJ2980-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CNBJ2980-t26_1-p1.