CAZyme Information: CNBI2040-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNBI2040-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	CM000048|CGC2	50638.54	10.2225

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansB-3501A	6608	283643	108	6500

• Gene Location: location=CM000048:566536-568173(-)

Full Sequence      

MSRQSLSSPALGQRKGLISHTVDLVRALLFDRRYFWHTAFLLFLGEVALSLLVIWKIPYT
KIDWPAYMQQVDMFLAGERDYSKIEGETGPLVYPALHLYIYTAFHRLLPSIENVRPAQFV
FLGFYLATYLAISTIYYLAGRPSNGGHHFPQVLLIPLTLSKRAHSIFLLRLFNDPIAMLI
FYLSVIAFQIGGRKGWRLGCVLFSLALGVKMNILNFLPGLLVLLFQYRGIVGTVEGLSII
GLIQFLLPAPFFFSKSNPYLIRAYFTSAFDFSRQFLYEWTVNWRFISEETFLSRERAVTL
LAGHLTVLGLFAAFKWSPVPGGTLRVLRKGFSDPLNQALEVSQVPAYHIPLVLFSANLIG
MLFARSLHYQFHSWYFHQLPFLLYSGAGWGNMLTSVLIWVTVQYAWETAPSTISTSAALL
AGHGAMVFGLFFHGMKRPSSSQKSKAK

Enzyme Prediction     

EC	2.4.1.258:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	40	416	1.1e-130	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	4.76e-170	40	416	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW46504.1|GT58	0.0	1	447	1	447
AFR94407.1|GT58	6.27e-304	1	447	1	447
AUB24060.1|GT58	6.27e-304	1	447	1	447
KGB78711.1|GT58	2.00e-300	1	447	1	447
ADV21666.1|GT58	8.16e-300	1	447	1	447

PDB Hits     

CNBI2040-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CN93|ALG3_CRYNB	0.0	1	447	1	447	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ALG3 PE=3 SV=1
sp|P0CN92|ALG3_CRYNJ	0.0	1	447	1	447	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ALG3 PE=3 SV=1
sp|Q9C1K8|ALG3_NEUCR	3.17e-91	42	447	40	435	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q92685|ALG3_HUMAN	3.88e-88	26	445	33	435	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG3 PE=1 SV=1
sp|Q55F69|ALG3_DICDI	5.42e-87	35	432	18	423	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000015

TMHMM  Annotations     

Start	End
33	55
119	141
166	188
200	222
232	254
297	314
346	368
381	403
413	435