CAZyme Information: CNBH1030-t26_2-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNBH1030-t26_2-p1
• CAZy Family: PL38
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522	CM000047|CGC3	58740.56	8.5873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansB-3501A	6608	283643	108	6500

• Gene Location: location=CM000047:268535-270535(+)

Full Sequence      

MARFPFFRILLRGNTPAKLLLLFFAVVFFFAFPFSSRPTSIFADPALREKAEVAPLSELA
SVYDQVRLDILDARRFNGSHAAEKLRAPKTLPDGTLNFDPDLETYVARLRGFVNNYLRSA
PAHIQIAGSNTLTTLVRRLPAKHRDGDFPSKVWATHPRGMDGVESGFELWGELLPFPLPP
SLANQLSPNHEVEFLKPARVGKDWDVEVLDDDALDSAMSEWTGEDIGRGITGEGKWSQLW
GKLDKGVLRADLFRYVSMLVEGGIYSDSDTMPISHPYVWGLHAPSILDQDLEVLNDLMVS
SLLPKFPTHNRPPRVDSRSIVDSDNSTYVPPYPGLRLTRRAPVYTVENPNPSSILNPSIS
MVVAIEWDSQIGRTLGMWKQWTWFRATRSWKDCCFPRGLQMVQNLLVSKPFHPIMMDIVA
TIAQLVETGLYEKLSPYGVTPDELRALRGPVRVGDILILQEEACHAPRKAIQRLKAFVDS
LHLKLGTNRHGRFSPWLFGLGYKDWKSGGVKVAYHGLTGIWK

Enzyme Prediction     

No EC number prediction in CNBH1030-t26_2-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.20e-06	246	300	144	200	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.89e-05	246	285	53	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UOH83342.1|GT0	0.0	1	522	1	542
AAW45413.1|GT0	0.0	1	522	1	542
KGB76775.2|GT0	0.0	1	522	1	542
ADV23826.1|GT0	0.0	1	522	1	542
AFR97169.2|GT0	0.0	1	522	1	542

PDB Hits     

CNBH1030-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

CNBH1030-t26_2-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.339942	0.660049	CS pos: 43-44. Pr: 0.5558

TMHMM  Annotations     

Start	End
19	41