CAZyme Information: CNBE3240-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNBE3240-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: putative chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
901		101270.07	8.5119

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansB-3501A	6608	283643	108	6500

• Gene Location: location=CM000044:872982-877108(-)

Full Sequence      

MTRHHDPFTNSARVDSSFTPSVNPNTPYPQSDQYQSYYPPQLTHYQGQQGYQPASSSTFL
TTDPYLSGGPDLPLASSASISSAGADFLTRQTAPRRGATTKRIKLTNGNFIADYAVPGPV
SSSVEAKWLIDKASNEFSHMRYTAATCDPDDFTPENGWKLKTTSYNRETELLIAITSYNE
DKILYARTLHNVMLNIRDICNTKASKFWRRSAEEGRPGWQKIVVALVADGLDPMDKQVLD
VLQTIGVFQDGILKKEVDGKKTAAHIFEQYTTQLSIDATPQLVQPHPGEPNNLVPVQIIF
VLKQENSKKINSHRWLFNALGRQLQPEICVLLDAGTKPGHKAIYHLWEAFYNNRNLGGAC
GEIHAMIKKGVKLFNPLVAAQNFEYKMSNILDKPLESSFGYVSVLPGAFSAYRYKAIQGR
PLTQYFHGDATLAARLGKKGIYGMGIFTKNMFLAEDRILCFELVAKKGEKWVLQYVKPSK
AETDVPEQAAELISQRRRWLNGSFAASVYSVFHFFRLYRSGHGPIRMLFLHIQAIYNVFS
LIFSWFALANLWLTFSIIIELLPESANINLFGTADVTHWINLVFTWVYLAFLMLQLVLAL
GNRPKGEKGLYILTLWVYAFLSLYLIICSIILSVVAFKVCYHLGALRDGGSIDAKLGNLF
NSTNGVLVAAIMSTIGIYLIASFLYRDPWHMFSSFPQYMLLAPSFTNILNVYAFCNLHDV
SWGTKGSDRAEALPAISSSKEKDGETAVVEEQQRSQGELDESFKQVVQRAVAPYKPEEAD
EKPNLDDQNRTFRTRLVVVWLLSNAALAISIQTLNGLDTTKQLVEACLPSSYNPDNGTVI
VSTNGTCITQALEHDGDKLQDKQQIYFQAILWATFALSMVRFIGCVFYWAMRQMGRCWRR
N

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	178	350	2.1e-67	0.9877300613496932

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	4.25e-94	178	350	2	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	6.06e-92	173	506	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	5.19e-33	102	176	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	8.96e-29	291	635	107	414	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	3.75e-16	277	417	38	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW43575.3|GT2	0.0	1	901	1	920
AUB25429.1|GT2	0.0	5	901	4	931
AFR95603.2|GT2	0.0	5	901	4	931
UOH82531.1|GT2	0.0	5	901	4	895
KGB79519.2|GT2	0.0	140	901	1	756

PDB Hits     

CNBE3240-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J9VMX7|CHS7_CRYNH	0.0	5	901	4	931	Chitin synthase 7 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS7 PE=2 SV=2
sp|P30598|CHS1_USTMA	0.0	47	901	104	919	Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS1 PE=3 SV=3
sp|P30602|CHS3_EXODE	9.47e-297	100	818	135	858	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|Q00757|CHSB_EMENI	1.78e-294	96	901	143	916	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P54267|CHSG_ASPFU	2.42e-293	96	901	138	911	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

Start	End
535	557
578	600
615	637
658	680
695	717
796	814
869	891