CAZyme Information: CNBC1160-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNBC1160-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793		77808.58	4.8169

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansB-3501A	6608	283643	108	6500

• Gene Location: location=CM000042:331791-334628(-)

Full Sequence      

MTQQHLATFTWGAGAQTVCVAGNFNDWSATATPLKKQSDGSFLADVSVPWGEKQAFKYVV
DGEWKVREDEAKEWDAAGNMNNVYTAPEGPDDKKPVDKSTATGATGASTSAGAGAGAGAA
AAASAHAKDPATKDATSKPPTTAVPPADTADTAPASTGNKKTDPEALIAAAAPGAAIGAP
ILGKPVAGAETAPTSGITTTTAIGSGTAAATETKTKDKAPVESATPFDNKAAADKAGVAE
KGTAKDTLSPGPVPVAMVAEKGTAKDTLSPGPVPVAIAVPTDKKAGLTEKGTAKDVNAPG
PIPGSTAASADTAAKADEPIDPAVAATTDSSGAVRVTAVDATPQQIEMVAAAANVGEAPT
ATVGGEHGLAEKAAEYGAAAMATFGSVVGGAAAAVEKATGVDLTHSSPLSVEEARARGID
VTNLEKVDAPTDTTSPQGSAPPASAVAALDEKVAELKSETIGASSTTGVTDQVAMPLPNQ
QAPKSTSLSLPPSKEVDTVSVDKGLSDWLDYTASYPADGSSTLGHTASTTDNKEKDIKND
IPAQPETADMNHRAVPAPVFTTIAPKDPKKDRSLGSSDLNDTAGTKPIDAAPGVDAKKAK
REEEANPTGATGEKPEVAEAKKAAAPDTPEDNLKLKSEDVGKGTGAGVGSASDGRAQVPQ
SGVKAETSLSSPSAATATTTETSQPASSATGTTATPSKTTAATTNGTSVPAAAAGYGGAV
AGAAGAVEAGGAGSTTTGASNTAAPSTPAGTKPTSTSTPTPGKESSSGPGSVKKKTGFLA
KIKHALSPGHKSK

Enzyme Prediction     

No EC number prediction in CNBC1160-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199889	E_set_AMPKbeta_like_N	5.22e-21	8	83	3	77	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
199892	E_set_Isoamylase_like_N	2.07e-16	8	83	4	83	N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins. E or "early" set domains are associated with the catalytic domain of isoamylase-like proteins at the N-terminal end. Isoamylase is one of the starch-debranching enzymes that catalyze the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen. Isoamylase contains a bound calcium ion, but this is not in the same position as the conserved calcium ion that has been reported in other alpha-amylase family enzymes. The N-terminal domain of isoamylase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and the beta subunit of AMP-activated protein kinase.
406865	AMPK1_CBM	2.95e-13	8	85	4	78	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
199885	E_set_GBE_prok_N	8.43e-05	8	64	22	82	N-terminal Early set domain associated with the catalytic domain of prokaryotic glycogen branching enzyme. This subfamily is composed of predominantly prokaryotic 1,4 alpha glucan branching enzymes, also called glycogen branching enzymes. E or "early" set domains are associated with the catalytic domain of glycogen branching enzymes at the N-terminal end. Glycogen branching enzyme catalyzes the formation of alpha-1,6 branch points in either glycogen or starch by cleavage of the alpha-1,4 glucosidic linkage, yielding a non-reducing end oligosaccharide chain, as well as the subsequent attachment of short glucosyl chains to the alpha-1,6 position. By increasing the number of non-reducing ends, glycogen is more reactive to synthesis and digestion as well as being more soluble. The N-terminal domain of the 1,4 alpha glucan branching enzyme may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
223021	PHA03247	7.82e-04	130	344	2751	2963	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW42516.2|CBM48	0.0	1	793	1	765
ALO60501.1|CBM48	0.0	1	793	1	740
UOH79902.1|CBM48	0.0	1	782	1	755
AFR93698.2|CBM48	0.0	1	793	1	741
AUB23268.1|CBM48	0.0	1	793	1	741

PDB Hits     

CNBC1160-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6ZT54|CRP1_YEAS7	8.85e-06	8	82	10	86	Cruciform DNA-recognizing protein 1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=CRP1 PE=3 SV=1
sp|B3LSR0|CRP1_YEAS1	8.85e-06	8	82	10	86	Cruciform DNA-recognizing protein 1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=CRP1 PE=3 SV=1
sp|C7GJZ2|CRP1_YEAS2	8.85e-06	8	82	10	86	Cruciform DNA-recognizing protein 1 OS=Saccharomyces cerevisiae (strain JAY291) OX=574961 GN=CRP1 PE=3 SV=1
sp|C8Z9U3|CRP1_YEAS8	8.85e-06	8	82	10	86	Cruciform DNA-recognizing protein 1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) OX=643680 GN=CRP1 PE=3 SV=1
sp|E7KDM2|CRP1_YEASA	8.85e-06	8	82	10	86	Cruciform DNA-recognizing protein 1 OS=Saccharomyces cerevisiae (strain AWRI796) OX=764097 GN=CRP1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CNBC1160-t26_1-p1.