CAZyme Information: CNBB2250-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNBB2250-t26_1-p1
• CAZy Family: CBM50|CBM50
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	CM000041|CGC1	47466.11	9.8177

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansB-3501A	6608	283643	108	6500

• Gene Location: location=CM000041:598153-599538(+)

Full Sequence      

MLRTKNSQIILLSLALHLALILYADHVDSHPERYGGLRYTDVDWRVVTDGARLIFIPTEK
EQAKGWLVKKIGLPIGDPYDRATFRYTPLLPLFLSPALIHPLLGKCLLALPSLLIPLLLL
TGPDPAPFWPTHLLWTINPFVLSITTRGSPEAAICFLVVTLHYFLRLGSGDEKKGAGETR
AAIMLALAVSWKIYPAIYIPAIWKELSTRWGWFGMRVWRFGLIVASSFVLINGALWSIWG
QPFLDHTYLYHLSRLDHRHNFSPYFYPIYLSFFPSPTASPLPSALLAVIRHPLASFLPQI
SLIITTSLSTSSLCFAMFLQTALFVAFNKVCTSQYFTWFLPLLPSVIPQLRLSRQKTAAL
VVAWILAQGVWLGSAYLLELRAQSVYIFVWAAGLLVFGVSIYLLGNVVDGWEPARTSKTK
LE

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	144	407	4.1e-79	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
252941	Mannosyl_trans	1.75e-59	144	408	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
178434	PLN02841	3.65e-52	28	408	30	415	GPI mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW41613.1|GT50	1.54e-305	1	422	1	422
AUB22890.1|GT50	6.03e-287	1	422	1	422
AFR93356.1|GT50	6.03e-287	1	422	1	422
UOH81399.1|GT50	1.11e-282	1	422	1	422
KGB75735.1|GT50	8.69e-278	1	422	1	423

PDB Hits     

CNBB2250-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5F380|PIGM_CHICK	2.96e-62	18	422	20	416	GPI mannosyltransferase 1 OS=Gallus gallus OX=9031 GN=PIGM PE=2 SV=2
sp|Q7T310|PIGM_DANRE	4.89e-60	37	413	32	386	GPI mannosyltransferase 1 OS=Danio rerio OX=7955 GN=pigm PE=2 SV=1
sp|Q54IA4|PIGM_DICDI	2.51e-58	6	418	25	437	GPI mannosyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=pigm PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	4.29e-58	5	420	9	418	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q9EQY6|PIGM_RAT	2.53e-56	37	418	45	418	GPI mannosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Pigm PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000719	0.999257	CS pos: 29-30. Pr: 0.8717

TMHMM  Annotations     

Start	End
181	203
218	240
261	283
303	325
360	382
386	408