CAZyme Information: CNB02330-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNB02330-t26_1-p1
• CAZy Family: CBM21
• CAZyme Description: beta-1,2-xylosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
631		71332.12	6.7221

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017342.1:672801-675593(+)

Full Sequence      

MPRYLRIYIAVAALALLAAVHYHLQPFSLARRRTPSTAQSYPLGLSAEDGQLVDSAGLVV
DEKGLVSYSPGHAARHPVEILIERGKTLADETESKIASVKSLKDSAMDYVTAFGMKPPQG
FEAWYAYTQSVPAPHPLSIPSLIPLAHRPMLPFLSHSASILRERVEALRETAESIFTLTF
VPDGQGDRGTACTANEKWNKMDWRVRGKGRVLVRGAAGWSWRCNNTLSLLLPLLPLMPEK
MFSHNPPLELAFSTEDGPRGLVHNTFRERSENLARAGRLWPKSQLHQAEQAMRWTYGFSW
SCPEHTPLKDHAADVILNDLPDIVSAQSQHVKEPKTFIADFDRSVDYCVNPDLMNSHNML
LSDQSIAAANLIPALVACKTKWNSDLVGVPLDGVYETVKFVPWEDKEVSKAFWRGSATGL
FHDKNKPWRQSQRERLHWFGTNMTGTVPLLLPDGSIKDWDRADLVDKWLDIGLSGGPTQC
DAEDGSCAAMAEEIDFKNRVTKQDAIKYKYVIDVDGNGWSSRFRRLLQGNNVVFKSTLYP
EWFHEILIPWYHYVPTKLDYSDVFDTLAFFQGSPDGSIPGRDDLAKEIAGHAYKFVQERW
REEDMRSFMYLLILEYWRLMSDDRKAASYQG

Enzyme Prediction     

No EC number prediction in CNB02330-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	367	620	5.7e-63	0.912

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.77e-20	381	620	63	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.05e-13	363	620	98	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW41853.2|GT90	0.0	1	631	1	631
AAR84598.1|GT90	0.0	1	564	1	521
AUB22757.1|GT90	0.0	1	631	1	637
AFR93241.2|GT90	0.0	1	631	1	637
KGB74299.2|GT90	0.0	1	615	1	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	7.98e-10	504	621	233	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	5.16e-72	76	624	152	660	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	8.81e-10	504	621	261	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	4.83e-09	504	621	261	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	6.41e-09	504	621	261	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	3.48e-08	504	616	358	463	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996558	0.003467

TMHMM  Annotations     

Start	End
7	24