CAZyme Information: CNAG_06985-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNAG_06985-t26_1-p1
• CAZy Family: GT69
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849		93129.71	5.9803

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansH99	8338	235443	1363	6975

• Gene Location: location=CP003831.1:764509-768109(-)

Full Sequence      

MTKVTIINPEAVLKELSSEEKIALLSGDDMWHTVAVPRLGVPRVRCSDGPNGVRGTAWTN
GAPASCFPSSTGLGASMDVDLVRRIGEALGEECRARGVHCLLGPTTNCQRHPCGGRGFES
FSEDPHLCGHIALAWIEGVQSKKVMITPKHFLANEQEYLRRSNNSVIDERTMHEIYLEPF
RIQCKARPAVFMTSYNRVNGLHAAEHPFLLRKILRGDFEFQGMIMSDWSGTYSSSEAVKA
SLDLEMPGPALMRGSSLERDIIGGKLVPADIDECALRVLRYVQEAQQSGIDFEKDEETID
TPYIRALLREAADSAVVLLKNDKGILPISFPNGKKIAVIGPSAKTASYAGGGSANLAPTY
LVTPLEAITTLASRVGARVEYTVGSDSSRWTPLLTPFIHHPTMGKDAGPGVQCDFYVQNP
WENKVKPIFSKYNNSAFSYFIDGIPKEVPIRGYVSLKAIFTPDESGIWELGLGVAGQADL
FIDGKKIVDNSTDQKEGLLFFNTGAEERTGELNVEAGKSYDLEVRFSNFKQLNAMSPYTG
RRGGIRIGGRKKRDAHAEIEKAVKLATESDIVILCIGTNSEWESEAYDRDDMKLPPGTDE
LARAILSSKPETIVVNQSGMPVEFPWLDDASAIVQAFFGGNECGTAVADAVFGIVNPSGK
LPITWPRVLEDYSSHEGFGHPINTVYSEGLGVGYRYFDRGNHPKSAFPFGHGLSYTSFTL
SELAVNPEAFGAKATFTITNTGEIDGAEVAQVYIHDLAPIVERPEHELAGFVKVHLRPGE
SKVVSVKLDHKAFSFYSVQEKCWVGRMGDYEIRIGTSSTLIHLSKPVHLARSFKWIGLQE
PQVYEPAWI

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	247	1.4e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.53e-73	67	818	120	754	beta-glucosidase BglX.
224389	BglX	1.79e-61	29	344	48	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.92e-50	316	694	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.99e-39	11	815	55	769	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	7.92e-31	38	280	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR98487.2|GH3	0.0	1	849	1	849
AUB28642.1|GH3	0.0	1	849	1	849
UOH85351.1|GH3	0.0	1	842	1	833
KNX49905.2|GH3	0.0	1	849	1	849
ADV25102.1|GH3	0.0	1	848	1	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.36e-194	10	838	7	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.95e-190	10	838	7	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	5.29e-125	7	834	3	673	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.58e-104	13	840	9	674	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.35e-96	12	829	57	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNN8|BGLJ_NEOFI	1.82e-214	10	838	15	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	5.24e-213	7	838	4	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	9.46e-212	10	838	15	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	2.67e-211	10	838	15	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|B8NDE2|BGLI_ASPFN	3.32e-211	7	838	4	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.981840	0.018177

TMHMM  Annotations     

There is no transmembrane helices in CNAG_06985-t26_1-p1.