CAZyme Information: CNAG_05188-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNAG_05188-t26_1-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273		31095.05	4.6583

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansH99	8338	235443	1363	6975

• Gene Location: location=CP003823.1:672675-673750(-)

Full Sequence      

MTPPSAKFTRASNTANVVTFVALSSFFFSVLYYALSPSPLLPFDTLSSYNAQSNKSNDMP
REAVPASYSRKLEAEGAIVIEKPLITSLPTVQTNPRWKDVYTKLWIFNMTSYDRLVYYDA
DHLVLRPVDSIWEAENSWPESALAALGSGDGGYVEDSDYFLAGFFIAIPKDEIMEGLLAE
KGYDPVFPEQNLMNKYFSRDGPRPWAPLDPIHERISPEYEHVEQGAHTIHEKCWQGWVER
RLAELFYERLGRMEGYWLAKEFNGTIPTPDPRG

Enzyme Prediction     

No EC number prediction in CNAG_05188-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	84	210	4.9e-17	0.5136186770428015

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	2.44e-47	64	262	40	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133064	GT8_GNT1	9.15e-07	84	129	64	109	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
227884	Gnt1	1.12e-05	96	210	152	313	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
132996	Glyco_transf_8	1.51e-04	92	197	75	197	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
215090	PLN00176	0.001	64	204	63	229	galactinol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB24113.1|GT8	1.04e-205	1	273	1	273
AGV14250.1|GT8	1.04e-205	1	273	1	273
AUB24114.1|GT8	8.68e-197	1	273	1	316
AFR94453.2|GT8	8.68e-197	1	273	1	316
UOH84644.1|GT8	7.70e-196	1	273	1	299

PDB Hits     

CNAG_05188-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CNAG_05188-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000001

TMHMM  Annotations     

Start	End
13	35