CAZyme Information: CNAG_04364-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNAG_04364-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: dolichyl-diphosphooligosaccharide-protein glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821	CP003828.1|CGC6	91097.29	8.3590

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansH99	8338	235443	1363	6975

• Gene Location: location=CP003828.1:679321-682201(+)

Full Sequence      

MAPKPAKAASKAAKSPTPAGTPTRQPSVDTLSKQAVIDTPPTPESPVQVSAPVPSKKFAY
PIPSHLSPSTINNTESLLRFVILALICGAAIGSRLFAVIRFESVIHEFDPWFNYRASKVL
VNEGFYEFWNWFDPSAWYPLGRTVGTTLYPGLMVTSGLIWHALRAINMPVDIRNVCVLLA
PGFSGLTAWATYLFTTEMSTPSAGLLAAAFIGIVPGYISRSVAGSYDNEAIAIFLLMSSF
YSWIKAVKTGSSFWGMITALFYGWMVAAWGGYVFITNMIPLHAFVLIVMGRFNNRLYTAY
SSWYAIGTIASMQVPFVEFLPIRTSEHMAALGVFGLLQLIGFVEVVRRLVPGKQFQLLLK
AFVVAVFCLSFAALVALTFSGWIAPFAGRFYSLWDTGYAKVHMPIIASVSEHQPTAWPSF
YFDLEMLIFFFPAGVFWCFKELRDEQIFIIIYAVLSAYFAGVMVRLMLVITPVVCVSAAI
AFSKLLEAYIDPVIPESDEEASESQTQAVSKSKAKKMAAANANKSGFSFTGILSGKSVSG
IFGLDTRFAVVSILSVFLFIFVLHCTYVTSTAYSSPSVVLASRNPDGSQNIIDDFREAYY
WIRQNTAEDSVIMSWWDYGYQIAGMADRPTLVDNNTWNNTHIATVGKAMASNEDVAYPIL
RKHDVDYVLVIFGGLLGYSGDDINKFLWMVRISQGEWPDEVQEINYFTQRGEYAVDDRAT
PTMKNSLMYKMSYYRFPELYGGHPAQDRVRGQIIPPNSVTLDTLDEAFTSENWIVRIYKV
KKEDPIGRDHKAVTAWNGGKKLKKSPSASEGVKRGSGRPSM

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	79	739	1.1e-187	0.8513708513708513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	7.21e-136	77	574	1	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	5.47e-103	77	800	18	749	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	2.93e-28	107	670	32	586	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).
227621	COG5305	0.005	76	385	15	314	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB27077.1|GT66	0.0	1	821	1	821
AFR97095.2|GT66	0.0	1	821	1	821
UOH83418.1|GT66	0.0	1	821	1	821
KGB76874.2|GT66	0.0	1	821	1	818
AAW45538.2|GT66	0.0	1	821	1	821

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	2.60e-307	75	788	13	690	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	7.58e-284	75	784	69	776	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	1.17e-254	75	787	15	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6FTJ_5	3.43e-254	75	781	15	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	1.33e-253	75	787	15	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	5.58e-307	78	803	24	738	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	1.34e-306	75	788	13	690	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|Q3TDQ1|STT3B_MOUSE	3.51e-283	75	784	66	773	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2
sp|Q8TCJ2|STT3B_HUMAN	3.90e-283	75	784	69	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
sp|E2RG47|STT3B_CANLF	5.52e-283	75	784	69	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

Start	End
77	99
138	160
172	194
204	223
230	247
267	289
296	318
328	350
362	384
417	439
448	470
541	563