CAZyme Information: CNAG_03735-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNAG_03735-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: beta-1,2-xylosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637		72906.52	5.4268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansH99	8338	235443	1363	6975

• Gene Location: location=CP003821.1:659468-662324(+)

Full Sequence      

MARYLRIYIAVAAIALLAAAHYLLQPFSLTRHRRATASSRTQSYSSSPGVFDEEDGQLID
SSGLVVDEKGLVSYSQDNATGHPIEMLIERGRKLAEEMDSKIASVTSVKDSVMDYVTAFG
MGPPRGFEAWYAYTQSVPAPHPPPLPSLIPLAHRPVLPFLSHPAALLRERVEKLRETDEF
IFTLTFVPDGQGDRGTACKTNEEWHAEDWRVRDNGRVLVRGAAAWSWRCNNTLTLLLPFL
PLMPEEMFIQTPPVELAFSVDDGPRGMIHNTFRERSEALARAGRLWPESQLQQAEQVMRW
TYGWSWSCPENTPLKDRGSDLVLNDLIDDLSAESQYGEESKTFIADFDKSVDYCMNPDLM
NLHHVLLSERHRAAVRLVPTLVTCRTKWNSDLVGVPLDGVFETVKFIPWEEKKNSKAFWR
GTATGLFHDKFSAWRQSQRERLHWFGTNTTGTVPLLLPDGSIKDWDRANLVDKWLDVGLS
GGPTQCNVEDGTCAVMAEEIDFKDRVNKQESLKYKYMIDVDGNGWSSRFRRLLQGNNVVF
KSTLYPEWFHDMLIPWYHYVPTKLDYSDIFDTLAFFQGSPDGRIPGRDDLAKEIAAHAYE
FVQERWREEDMRSFMYLLLLEYWRLMSDDRKATSYQG

Enzyme Prediction     

No EC number prediction in CNAG_03735-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	374	626	3.4e-62	0.908

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.66e-21	387	626	63	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.84e-12	408	626	154	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB22757.1|GT90	0.0	1	637	1	637
AFR93241.2|GT90	0.0	1	637	1	637
UOH81501.1|GT90	0.0	1	621	1	621
AAW41853.2|GT90	0.0	1	637	1	631
KGB74299.2|GT90	0.0	1	633	1	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.61e-11	408	627	171	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	3.19e-10	489	631	253	384	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	7.94e-77	82	630	152	660	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	1.66e-11	408	636	199	382	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q7ZVE6|PLGT2_DANRE	1.33e-10	369	622	241	462	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|Q8NBL1|PGLT1_HUMAN	2.87e-10	408	627	199	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	3.81e-10	408	627	199	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.989625	0.010388

TMHMM  Annotations     

Start	End
7	24