CAZyme Information: CNAG_03480-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNAG_03480-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: NAD epimerase domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1125	CP003827.1|CGC6	125051.02	6.3434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansH99	8338	235443	1363	6975

• Gene Location: location=CP003827.1:1071785-1075494(-)

Full Sequence      

MAPAQPPLRRLLLPLHKPRFLALLILPLIVLILHTNQLSKSPSLKAKVKEAPQGGSWEAL
TNVDDDWGIHEGTWGGGVKDWFGWKDKGRTSILITGGAGQLGQALIPELINNYTVHIQDI
VPRPPSLPSSIIYHRSSSTSSAEVYKSIFASNTFDGVIHLAGISLDAWCAAKEDECYEVN
VGGTKALMNEIIAVNKQSKRGRMSKNVRVPWVILGSTMEVFGPEGTNEDSPKHPDSAIGK
TKMKAEQVFEEAIVNGPGKESIRGLILRFPEVYGYRSASSIPDAFIPSLLTNSLTFLPIQ
YSSNQIPYDLLHAEDAIIGFVKAISYVEGTPDGDVSSINLVSGQRIPARDIVELVRKETT
SMSPVRDIGDNRNPNAHEYSPTKAAEILSWQAEIAPLVGLGKAITQLTEDIAIYFRSYLH
EHCPPSADFPAPDGDLAVSFIEDERNKPLWKLDGCTVNLGFNHEGWIHHLKCHDGKHCKV
DDVKMTALSWNQSTFIIEKVEKKQRERIGRVMLKEQNGMGYLGMTQREGEVGFELYKDSK
EGQTVFDLEVRRDSSDLRLLVPDSEMQLHAVSNKTDGSTWFIVEPITRWVHPHFDMRINV
LCCPFEGDWPLLLDDYESADVRFGSTGQIPFDSTRRSHLCTRAEQAVRYNFKHLSTARQA
VSKVTGTAGHAFFNETGPKTDPHPHAWALKDLPACWNNCESPTVCVQTGTCKCVQADHCK
PRRENPLLKIYPSNSVHPDENTSPRDALAKAVEAVDWKELLLPAARTALEAHPNFVKVHV
ADGYKGQEEIEAAPCHKLQETNCFSADSIMYKALRHISVPADEAELVVLPVYQHCTGAQF
LLHDAMHHASETIPGVKNGEKTVALVLTHDWGICLDFAGDIWSARDQHALYPDRILDNVL
VWSVMGDYDSPCYRPHQDVVVPARTCGTNTVRGTFPNVGSIKPMSERSNLLMWAGTHWVT
GKSERIRLTCDRGGAGDRELIKGGGKQSNFANGDYINDLNNARFCPQPRGITGWSPQTND
AIYAGCIPVFIAEGTHYPFAGFLDWSKLSVRVAPTELDKIEKILAAIPLSKVEELQANLV
SVREAFLYSGDEKPEEELERRGPIFFALHEAGMRIRTRYPVKEEE

Enzyme Prediction     

No EC number prediction in CNAG_03480-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT47	776	1067	1.5e-40	0.9831081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397245	Exostosin	3.25e-66	772	1067	1	290	Exostosin family. The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on 8q24.1, EXT2 on 11p11-13, and EXT3 on 19p have been associated with the autosomal dominant disorder known as hereditary multiple exostoses (HME). This is the most common known skeletal dysplasia. The chromosomal locations of other EXT genes suggest association with other forms of neoplasia. EXT1 and EXT2 have both been shown to encode a heparan sulphate polymerase with both D-glucuronyl (GlcA) and N-acetyl-D-glucosaminoglycan (GlcNAC) transferase activities. The nature of the defect in heparan sulphate biosynthesis in HME is unclear.
223528	WcaG	6.16e-27	92	404	3	305	Nucleoside-diphosphate-sugar epimerase [Cell wall/membrane/envelope biogenesis].
212494	SDR_e	2.53e-23	92	340	1	199	extended (e) SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
396097	Epimerase	2.23e-21	92	332	1	233	NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions.
187549	Gne_like_SDR_e	1.06e-15	91	273	2	172	Escherichia coli Gne (a nucleoside-diphosphate-sugar 4-epimerase)-like, extended (e) SDRs. Nucleoside-diphosphate-sugar 4-epimerase has the characteristic active site tetrad and NAD-binding motif of the extended SDR, and is related to more specifically defined epimerases such as UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), which catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup includes Escherichia coli 055:H7 Gne, a UDP-GlcNAc 4-epimerase, essential for O55 antigen synthesis. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR96705.1|GT47	0.0	1	1125	1	1125
AUB26654.1|GT47	0.0	1	1125	1	1125
UOH83106.1|GT47	0.0	1	1125	1	1125
AAW44475.1|GT47	0.0	1	1125	1	1132
KGB76296.2|GT47	0.0	1	1125	1	1130

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A9W_A	7.36e-08	92	277	2	172	Chain A, NDP-sugar epimerase [Thermoplasma volcanium],3A9W_B Chain B, NDP-sugar epimerase [Thermoplasma volcanium],3AJR_A Chain A, NDP-sugar epimerase [Thermoplasma volcanium GSS1],3AJR_B Chain B, NDP-sugar epimerase [Thermoplasma volcanium GSS1]
3A1N_A	9.80e-08	92	277	2	172	Chain A, NDP-sugar epimerase [Thermoplasma volcanium],3A1N_B Chain B, NDP-sugar epimerase [Thermoplasma volcanium],3A4V_A Chain A, NDP-sugar epimerase [Thermoplasma volcanium],3A4V_B Chain B, NDP-sugar epimerase [Thermoplasma volcanium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8S1X9|GT13_ORYSJ	1.93e-12	804	1094	83	379	Probable glucuronosyltransferase Os01g0926400 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0926400 PE=2 SV=1
sp|Q3EAR7|GLYT2_ARATH	2.26e-11	994	1094	348	448	Probable glycosyltransferase At3g42180 OS=Arabidopsis thaliana OX=3702 GN=At3g42180 PE=2 SV=2
sp|Q9HDU3|GAL10_SCHPO	1.83e-10	92	395	8	329	Bifunctional protein gal10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gal10 PE=3 SV=1
sp|Q8S1X8|GT14_ORYSJ	3.01e-10	995	1094	271	372	Probable glucuronosyltransferase Os01g0926600 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0926600 PE=2 SV=1
sp|Q6ZDJ7|UGE2_ORYSJ	3.87e-10	88	393	10	330	UDP-glucose 4-epimerase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=UGE-2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999945	0.000073

TMHMM  Annotations     

There is no transmembrane helices in CNAG_03480-t26_1-p1.